Recombinant Full Length Human HP Protein, C-Flag-tagged
Cat.No. : | HP-820HFL |
Product Overview : | Recombinant Full Length Human HP Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a preproprotein, which is processed to yield both alpha and beta chains, which subsequently combine as a tetramer to produce haptoglobin. Haptoglobin functions to bind free plasma hemoglobin, which allows degradative enzymes to gain access to the hemoglobin, while at the same time preventing loss of iron through the kidneys and protecting the kidneys from damage by hemoglobin. Mutations in this gene and/or its regulatory regions cause ahaptoglobinemia or hypohaptoglobinemia. This gene has also been linked to diabetic nephropathy, the incidence of coronary artery disease in type 1 diabetes, Crohn's disease, inflammatory disease behavior, primary sclerosing cholangitis, susceptibility to idiopathic Parkinson's disease, and a reduced incidence of Plasmodium falciparum malaria. The protein encoded also exhibits antimicrobial activity against bacteria. A similar duplicated gene is located next to this gene on chromosome 16. Multiple transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 43.3 kDa |
AA Sequence : | MSALGAVIALLLWGQLFAVDSGNDVTDIADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLND KKQWINKAVGDKLPECEADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNNEKQWINKAVGD KLPECEAVCGKPKNPANPVQRILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLLTTAKNLFLNHSE NATAKDIAPTLTLYVGKKQLVEIEKVVLHPNYSQVDIGLIKLKQKVSVNERVMPICLPSKDYAEVGRVGY VSGWGRNANFKFTDHLKYVMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILNEHTFCAGMSKYQEDT CYGDAGSAFAVHDLEEDTWYATGILSFDKSCAVAEYGVYVKVTSIQDWVQKTIAENTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protease, Secreted Protein, Transmembrane |
Full Length : | Full L. |
Gene Name | HP haptoglobin [ Homo sapiens (human) ] |
Official Symbol | HP |
Synonyms | BP; HPA1S; HP2ALPHA2 |
Gene ID | 3240 |
mRNA Refseq | NM_005143.5 |
Protein Refseq | NP_005134.1 |
MIM | 140100 |
UniProt ID | P00738 |
◆ Recombinant Proteins | ||
HP-5101H | Recombinant Human HP, His-tagged | +Inquiry |
HP-957R | Recombinant Rat Haptoglobin Protein (Met1-Asn347), His-tagged | +Inquiry |
HP-1093H | Recombinant Human HP Protein, His (Fc)-Avi-tagged | +Inquiry |
Hp-1162M | Recombinant Mouse Hp Protein, MYC/DDK-tagged | +Inquiry |
HP-1891H | Recombinant Human HP Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
HP-191E | Native Equine Haptoglobin | +Inquiry |
Hp-134M | Native Mouse Haptoglobin | +Inquiry |
HP-26196TH | Native Human HP | +Inquiry |
HP-8153H | Native Human Serum Haptoglobin | +Inquiry |
HP-75C | Native Canine Haptoglobin | +Inquiry |
◆ Cell & Tissue Lysates | ||
HP-5408HCL | Recombinant Human HP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HP Products
Required fields are marked with *
My Review for All HP Products
Required fields are marked with *
0
Inquiry Basket