Recombinant Full Length Human HPCAL4 Protein, GST-tagged
| Cat.No. : | HPCAL4-3620HF |
| Product Overview : | Human HPCAL4 full-length ORF ( AAH30827, 1 a.a. - 191 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 191 amino acids |
| Description : | The protein encoded by this gene is highly similar to human hippocalcin protein and hippocalcin like-1 protein. It also has similarity to rat neural visinin-like Ca2+-binding protein-type 1 and 2 proteins. This encoded protein may be involved in the calcium-dependent regulation of rhodopsin phosphorylation. The transcript of this gene has multiple polyadenylation sites. [provided by RefSeq |
| Molecular Mass : | 46.75 kDa |
| AA Sequence : | MGKTNSKLAPEVLEDLVQNTEFSEQELKQWYKGFLKDCPSGILNLEEFQQLYIKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSVTSRGSFEQKLNWAFEMYDLDGDGRITRLEMLEIIEAIYKMVGTVIMMRMNQDGLTPQQRVDKIFKKMDQDKDDQITLEEFKEAAKSDASIVLLLQCDMQK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HPCAL4 hippocalcin like 4 [ Homo sapiens ] |
| Official Symbol | HPCAL4 |
| Synonyms | HPCAL4; hippocalcin like 4; hippocalcin-like protein 4; DKFZp761G122; HLP4; |
| Gene ID | 51440 |
| mRNA Refseq | NM_016257 |
| Protein Refseq | NP_057341 |
| MIM | 619211 |
| UniProt ID | Q9UM19 |
| ◆ Recombinant Proteins | ||
| HPCAL4-2899R | Recombinant Rat HPCAL4 Protein | +Inquiry |
| HPCAL4-5005H | Recombinant Human HPCAL4 Protein, GST-tagged | +Inquiry |
| HPCAL4-6463Z | Recombinant Zebrafish HPCAL4 | +Inquiry |
| Hpcal4-3433M | Recombinant Mouse Hpcal4 Protein, Myc/DDK-tagged | +Inquiry |
| HPCAL4-3620HF | Recombinant Full Length Human HPCAL4 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HPCAL4-5405HCL | Recombinant Human HPCAL4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HPCAL4 Products
Required fields are marked with *
My Review for All HPCAL4 Products
Required fields are marked with *
