Recombinant Full Length Human HPRT1 Protein, C-Flag-tagged
Cat.No. : | HPRT1-619HFL |
Product Overview : | Recombinant Full Length Human HPRT1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a transferase, which catalyzes conversion of hypoxanthine to inosine monophosphate and guanine to guanosine monophosphate via transfer of the 5-phosphoribosyl group from 5-phosphoribosyl 1-pyrophosphate. This enzyme plays a central role in the generation of purine nucleotides through the purine salvage pathway. Mutations in this gene result in Lesch-Nyhan syndrome or gout. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 24.4 kDa |
AA Sequence : | MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKG GYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTG KTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISE TGKAKYKATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Stem cell - Pluripotency |
Protein Pathways : | Drug metabolism - other enzymes, Metabolic pathways, Purine metabolism |
Full Length : | Full L. |
Gene Name | HPRT1 hypoxanthine phosphoribosyltransferase 1 [ Homo sapiens (human) ] |
Official Symbol | HPRT1 |
Synonyms | HPRT; HGPRT |
Gene ID | 3251 |
mRNA Refseq | NM_000194.3 |
Protein Refseq | NP_000185.1 |
MIM | 308000 |
UniProt ID | P00492 |
◆ Recombinant Proteins | ||
HPRT1-950H | Recombinant Human HPRT1 protein, His-tagged | +Inquiry |
HPRT1-2896H | Recombinant Human HPRT1 protein, His-tagged | +Inquiry |
HPRT1-5113H | Recombinant Human HPRT1 protein, His-tagged | +Inquiry |
HPRT1-948H | Recombinant Human HPRT1 protein, His-tagged | +Inquiry |
HPRT1-5124H | Recombinant Human HPRT1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HPRT1-5398HCL | Recombinant Human HPRT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HPRT1 Products
Required fields are marked with *
My Review for All HPRT1 Products
Required fields are marked with *
0
Inquiry Basket