Recombinant Full Length Human HPRT1 Protein, GST-tagged

Cat.No. : HPRT1-3628HF
Product Overview : Human HPRT1 full-length ORF ( AAH00578, 1 a.a. - 218 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 218 amino acids
Description : The protein encoded by this gene is a transferase, which catalyzes conversion of hypoxanthine to inosine monophosphate and guanine to guanosine monophosphate via transfer of the 5-phosphoribosyl group from 5-phosphoribosyl 1-pyrophosphate. This enzyme plays a central role in the generation of purine nucleotides through the purine salvage pathway. Mutations in this gene result in Lesch-Nyhan syndrome or gout
Molecular Mass : 49.72 kDa
AA Sequence : MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HPRT1 hypoxanthine phosphoribosyltransferase 1 [ Homo sapiens ]
Official Symbol HPRT1
Synonyms HPRT1; hypoxanthine phosphoribosyltransferase 1; HPRT; hypoxanthine-guanine phosphoribosyltransferase; HGPRT; Lesch Nyhan syndrome; HGPRTase;
Gene ID 3251
mRNA Refseq NM_000194
Protein Refseq NP_000185
MIM 308000
UniProt ID P00492

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HPRT1 Products

Required fields are marked with *

My Review for All HPRT1 Products

Required fields are marked with *

0
cart-icon
0
compare icon