Recombinant Full Length Human HPRT1 Protein, GST-tagged
Cat.No. : | HPRT1-3628HF |
Product Overview : | Human HPRT1 full-length ORF ( AAH00578, 1 a.a. - 218 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 218 amino acids |
Description : | The protein encoded by this gene is a transferase, which catalyzes conversion of hypoxanthine to inosine monophosphate and guanine to guanosine monophosphate via transfer of the 5-phosphoribosyl group from 5-phosphoribosyl 1-pyrophosphate. This enzyme plays a central role in the generation of purine nucleotides through the purine salvage pathway. Mutations in this gene result in Lesch-Nyhan syndrome or gout |
Molecular Mass : | 49.72 kDa |
AA Sequence : | MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HPRT1 hypoxanthine phosphoribosyltransferase 1 [ Homo sapiens ] |
Official Symbol | HPRT1 |
Synonyms | HPRT1; hypoxanthine phosphoribosyltransferase 1; HPRT; hypoxanthine-guanine phosphoribosyltransferase; HGPRT; Lesch Nyhan syndrome; HGPRTase; |
Gene ID | 3251 |
mRNA Refseq | NM_000194 |
Protein Refseq | NP_000185 |
MIM | 308000 |
UniProt ID | P00492 |
◆ Recombinant Proteins | ||
HPRT1-2895H | Recombinant Human HPRT1 protein, His-tagged | +Inquiry |
HPRT1-2905R | Recombinant Rat HPRT1 Protein | +Inquiry |
HPRT1-4769H | Recombinant Human HPRT1 protein, His-tagged | +Inquiry |
HPRT1-2896H | Recombinant Human HPRT1 protein, His-tagged | +Inquiry |
HPRT1-595C | Recombinant Cynomolgus HPRT1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HPRT1-5398HCL | Recombinant Human HPRT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HPRT1 Products
Required fields are marked with *
My Review for All HPRT1 Products
Required fields are marked with *
0
Inquiry Basket