Recombinant Full Length Human HRAS Protein, GST-tagged
Cat.No. : | HRAS-3650HF |
Product Overview : | Human HRAS full-length ORF ( NP_005334, 1 a.a. - 189 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 189 amino acids |
Description : | This gene belongs to the Ras oncogene family, whose members are related to the transforming genes of mammalian sarcoma retroviruses. The products encoded by these genes function in signal transduction pathways. These proteins can bind GTP and GDP, and they have intrinsic GTPase activity. This protein undergoes a continuous cycle of de- and re-palmitoylation, which regulates its rapid exchange between the plasma membrane and the Golgi apparatus. Mutations in this gene cause Costello syndrome, a disease characterized by increased growth at the prenatal stage, growth deficiency at the postnatal stage, predisposition to tumor formation, mental retardation, skin and musculoskeletal abnormalities, distinctive facial appearance and cardiovascular abnormalities. Defects in this gene are implicated in a variety of cancers, including bladder cancer, follicular thyroid cancer, and oral squamous cell carcinoma. Multiple transcript variants, which encode different isoforms, have been identified for this gene. [provided by RefSeq |
Molecular Mass : | 46.42 kDa |
AA Sequence : | MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKCVLS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HRAS v-Ha-ras Harvey rat sarcoma viral oncogene homolog [ Homo sapiens ] |
Official Symbol | HRAS |
Synonyms | HRAS; v-Ha-ras Harvey rat sarcoma viral oncogene homolog; HRAS1; GTPase HRas; p21ras; H-Ras-1; p19 H-RasIDX protein; c-has/bas p21 protein; transforming protein p21; Ha-Ras1 proto-oncoprotein; c-ras-Ki-2 activated oncogene; GTP- and GDP-binding peptide B; transformation gene: oncogene HAMSV; Ras family small GTP binding protein H-Ras; CTLO; HAMSV; K-RAS; N-RAS; RASH1; C-H-RAS; H-RASIDX; C-BAS/HAS; C-HA-RAS1; |
Gene ID | 3265 |
mRNA Refseq | NM_001130442 |
Protein Refseq | NP_001123914 |
MIM | 190020 |
UniProt ID | P01112 |
◆ Recombinant Proteins | ||
HRAS-1884H | Recombinant Human HRAS Protein, MYC/DDK-tagged | +Inquiry |
HRAS-589H | Recombinant Human HRAS, His-tagged | +Inquiry |
HRAS-3650HF | Recombinant Full Length Human HRAS Protein, GST-tagged | +Inquiry |
Hras-1169M | Recombinant Mouse Hras Protein, MYC/DDK-tagged | +Inquiry |
HRAS-28759TH | Recombinant Human HRAS | +Inquiry |
◆ Cell & Tissue Lysates | ||
HRAS-556HCL | Recombinant Human HRAS cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HRAS Products
Required fields are marked with *
My Review for All HRAS Products
Required fields are marked with *