Recombinant Full Length Human HS3ST1 Protein, GST-tagged
Cat.No. : | HS3ST1-3693HF |
Product Overview : | Human HS3ST1 full-length ORF ( NP_005105.1, 1 a.a. - 307 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 307 amino acids |
Description : | Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. The enzyme encoded by this gene is a member of the heparan sulfate biosynthetic enzyme family. It possesses both heparan sulfate glucosaminyl 3-O-sulfotransferase activity, anticoagulant heparan sulfate conversion activity, and is a rate limiting enzyme for synthesis of anticoagulant heparan. This enzyme is an intraluminal Golgi resident protein. [provided by RefSeq |
Molecular Mass : | 62.2 kDa |
AA Sequence : | MAALLLGAVLLVAQPQLVPSRPAELGQQELLRKAGTLQDDVRDGVAPNGSAQQLPQTIIIGVRKGGTRALLEMLSLHPDVAAAENEVHFFDWEEHYSHGLGWYLSQMPFSWPHQLTVEKTPAYFTSPKVPERVYSMNPSIRLLLILRDPSERVLSDYTQVFYNHMQKHKPYPSIEEFLVRDGRLNVDYKALNRSLYHVHMQNWLRFFPLRHIHIVDGDRLIRDPFPEIQKVERFLKLSPQINASNFYFNKTKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELVGRTFDWH |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HS3ST1 heparan sulfate (glucosamine) 3-O-sulfotransferase 1 [ Homo sapiens ] |
Official Symbol | HS3ST1 |
Synonyms | HS3ST1; heparan sulfate (glucosamine) 3-O-sulfotransferase 1; heparan sulfate glucosamine 3-O-sulfotransferase 1; 3OST1; 3-OST-1; h3-OST-1; heparan sulfate 3-O-sulfotransferase 1; heparin-glucosamine 3-O-sulfotransferase; heparan sulfate D-glucosaminyl 3-O-sulfotransferase 1; 3OST; |
Gene ID | 9957 |
mRNA Refseq | NM_005114 |
Protein Refseq | NP_005105 |
MIM | 603244 |
UniProt ID | O14792 |
◆ Recombinant Proteins | ||
HS3ST1-2571R | Recombinant Rat HS3ST1 Protein, His (Fc)-Avi-tagged | +Inquiry |
HS3ST1-1970H | Active Recombinant Human Heparan Sulfate (glucosamine) 3-O-Sulfotransferase 1, His-tagged | +Inquiry |
HS3ST1-2320H | Recombinant Human HS3ST1, His-tagged | +Inquiry |
HS3ST1-429H | Recombinant Human HS3ST1 Protein, His-tagged | +Inquiry |
HS3ST1-2146R | Recombinant Rhesus monkey HS3ST1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HS3ST1-5387HCL | Recombinant Human HS3ST1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HS3ST1 Products
Required fields are marked with *
My Review for All HS3ST1 Products
Required fields are marked with *