Recombinant Full Length Human HSD17B14 Protein, C-Flag-tagged
Cat.No. : | HSD17B14-534HFL |
Product Overview : | Recombinant Full Length Human HSD17B14 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | 17-beta-hydroxysteroid dehydrogenases, such as HSD17B14, are primarily involved in metabolism of steroids at the C17 position and also of other substrates, such as fatty acids, prostaglandins, and xenobiotics. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 28.1 kDa |
AA Sequence : | MATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVK TLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINIS SLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGM LAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIPSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | HSD17B14 hydroxysteroid 17-beta dehydrogenase 14 [ Homo sapiens (human) ] |
Official Symbol | HSD17B14 |
Synonyms | DHRS10; SDR47C1; retSDR3 |
Gene ID | 51171 |
mRNA Refseq | NM_016246.3 |
Protein Refseq | NP_057330.2 |
MIM | 612832 |
UniProt ID | Q9BPX1 |
◆ Recombinant Proteins | ||
HSD17B14-13957H | Recombinant Human HSD17B14, His-tagged | +Inquiry |
HSD17B14-2877H | Recombinant Human HSD17B14, His-tagged | +Inquiry |
HSD17B14-3856HF | Recombinant Full Length Human HSD17B14 Protein, GST-tagged | +Inquiry |
HSD17B14-28397TH | Recombinant Human HSD17B14, His-tagged | +Inquiry |
HSD17B14-1103H | Recombinant Human HSD17B14 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSD17B14-470HCL | Recombinant Human HSD17B14 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSD17B14 Products
Required fields are marked with *
My Review for All HSD17B14 Products
Required fields are marked with *
0
Inquiry Basket