Recombinant Full Length Human HSD17B4 Protein, C-Flag-tagged
Cat.No. : | HSD17B4-429HFL |
Product Overview : | Recombinant Full Length Human HSD17B4 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a bifunctional enzyme that is involved in the peroxisomal beta-oxidation pathway for fatty acids. It also acts as a catalyst for the formation of 3-ketoacyl-CoA intermediates from both straight-chain and 2-methyl-branched-chain fatty acids. Defects in this gene that affect the peroxisomal fatty acid beta-oxidation activity are a cause of D-bifunctional protein deficiency (DBPD). An apparent pseudogene of this gene is present on chromosome 8. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 79.5 kDa |
AA Sequence : | MGSPLRFDGRVVLVTGAGAGLGRAYALAFAERGALVVVNDLGGDFKGVGKGSLAADKVVEEIRRRGGKAV ANYDSVEEGEKVVKTALDAFGRIDVVVNNAGILRDRSFARISDEDWDIIHRVHLRGSFQVTRAAWEHMKK QKYGRIIMTSSASGIYGNFGQANYSAAKLGLLGLANSLAIEGRKSNIHCNTIAPNAGSRMTQTVMPEDLV EALKPEYVAPLVLWLCHESCEENGGLFEVGAGWIGKLRWERTLGAIVRQKNHPMTPEAVKANWKKICDFE NASKPQSIQESTGSIIEVLSKIDSEGGVSANHTSRATSTATSGFAGAIGQKLPPFSYAYTELEAIMYALG VGASIKDPKDLKFIYEGSSDFSCLPTFGVIIGQKSMMGGGLAEIPGLSINFAKVLHGEQYLELYKPLPRA GKLKCEAVVADVLDKGSGVVIIMDVYSYSEKELICHNQFSLFLVGSGGFGGKRTSDKVKVAVAIPNRPPD AVLTDTTSLNQAALYRLSGDWNPLHIDPNFASLAGFDKPILHGLCTFGFSARRVLQQFADNDVSRFKAIK ARFAKPVYPGQTLQTEMWKEGNRIHFQTKVQETGDIVISNAYVDLAPTSGTSAKTPSEGGKLQSTFVFEE IGRRLKDIGPEVVKKVNAVFEWHITKGGNIGAKWTIDLKSGSGKVYQGPAKGAADTTIILSDEDFMEVVLGKLDPQKAFFSGRLKARGNIMLSQKLQMILKDYAKL |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Metabolic pathways, Primary bile acid biosynthesis |
Full Length : | Full L. |
Gene Name | HSD17B4 hydroxysteroid 17-beta dehydrogenase 4 [ Homo sapiens (human) ] |
Official Symbol | HSD17B4 |
Synonyms | DBP; MFE-2; MFP-2; MPF-2; PRLTS1; SDR8C1 |
Gene ID | 3295 |
mRNA Refseq | NM_000414.4 |
Protein Refseq | NP_000405.1 |
MIM | 601860 |
UniProt ID | P51659 |
◆ Recombinant Proteins | ||
Hsd17b4-1180M | Recombinant Mouse Hsd17b4 Protein, MYC/DDK-tagged | +Inquiry |
HSD17B4-429HFL | Recombinant Full Length Human HSD17B4 Protein, C-Flag-tagged | +Inquiry |
HSD17B4-110H | Recombinant Human HSD17B4 protein, MYC/DDK-tagged | +Inquiry |
HSD17B4-1417H | Recombinant Human HSD17B4 Protein (1-736 aa), His-tagged | +Inquiry |
HSD17B4-13960H | Recombinant Human HSD17B4, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSD17B4-5373HCL | Recombinant Human HSD17B4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HSD17B4 Products
Required fields are marked with *
My Review for All HSD17B4 Products
Required fields are marked with *
0
Inquiry Basket