Recombinant Full Length Human HSD17B6 Protein, GST-tagged

Cat.No. : HSD17B6-3872HF
Product Overview : Human HSD17B6 full-length ORF ( AAH20710, 1 a.a. - 317 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 317 amino acids
Description : The protein encoded by this gene has both oxidoreductase and epimerase activities and is involved in androgen catabolism. The oxidoreductase activity can convert 3 alpha-adiol to dihydrotestosterone, while the epimerase activity can convert androsterone to epi-androsterone. Both reactions use NAD+ as the preferred cofactor. This gene is a member of the retinol dehydrogenase family. Transcript variants utilizing alternative polyadenylation signals exist. [provided by RefSeq
Molecular Mass : 60.61 kDa
AA Sequence : MWLYLAAFVGLYYLLHWYRERQVVSHLQDKYVFITGCDSGFGNLLARQLDARGLRVLAACLTEKGAEQLRGQTSDRLETVTLDVTKMESIAAATQWVKEHVGDRGLWGLVNNAGILTPITLCEWLNTEDSMNMLKVNLIGVIQVTLSMLPLVRRARGRIVNVSSILGRVAFFVGGYCVSKYGVEAFSDILRREIQHFGVKISIVEPGYFRTGMTNMTQSLERMKQSWKEAPKHIKETYGQQYFDALYNIMKEGLLNCSTNLNLVTDCMEHALTSVHPRTRYSAGWDAKFFFIPLSYLPTSLADYILTRSWPKPAQAV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HSD17B6 hydroxysteroid (17-beta) dehydrogenase 6 homolog (mouse) [ Homo sapiens ]
Official Symbol HSD17B6
Synonyms HSD17B6; hydroxysteroid (17-beta) dehydrogenase 6 homolog (mouse); hydroxysteroid (17 beta) dehydrogenase 6; 17-beta-hydroxysteroid dehydrogenase type 6; 3(alpha >beta) hydroxysteroid epimerasel; 3 hydroxysteroid epimerase; HSE; NAD+ dependent 3 alpha hydroxysteroid dehydrogenase; oxidative 3 alpha hydroxysteroid dehydrogenase; oxidoreductase; retinol dehydrogenase; RODH; SDR9C6; short chain dehydrogenase/reductase family 9C; member 6; 17-beta-HSD6; 17-beta-HSD 6; 3-alpha-> beta-HSE; 3-hydroxysteroid epimerase; beta-hydroxysteroid epimerase; 3(alpha-> beta)-hydroxysteroid epimerase; beta)-hydroxysteroid epimerasel; oxidative 3-alpha hydroxysteroid dehydrogenase; oxidative 3-alpha-hydroxysteroid-dehydrogenase; short chain dehydrogenase/reductase family 9C, member 6; NAD+ -dependent 3 alpha-hydroxysteroid dehydrogenase 3-hydroxysteroid epimerase;
Gene ID 8630
mRNA Refseq NM_003725
Protein Refseq NP_003716
MIM 606623
UniProt ID O14756

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HSD17B6 Products

Required fields are marked with *

My Review for All HSD17B6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon