Recombinant Full Length Human HSD17B6 Protein, GST-tagged
Cat.No. : | HSD17B6-3872HF |
Product Overview : | Human HSD17B6 full-length ORF ( AAH20710, 1 a.a. - 317 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 317 amino acids |
Description : | The protein encoded by this gene has both oxidoreductase and epimerase activities and is involved in androgen catabolism. The oxidoreductase activity can convert 3 alpha-adiol to dihydrotestosterone, while the epimerase activity can convert androsterone to epi-androsterone. Both reactions use NAD+ as the preferred cofactor. This gene is a member of the retinol dehydrogenase family. Transcript variants utilizing alternative polyadenylation signals exist. [provided by RefSeq |
Molecular Mass : | 60.61 kDa |
AA Sequence : | MWLYLAAFVGLYYLLHWYRERQVVSHLQDKYVFITGCDSGFGNLLARQLDARGLRVLAACLTEKGAEQLRGQTSDRLETVTLDVTKMESIAAATQWVKEHVGDRGLWGLVNNAGILTPITLCEWLNTEDSMNMLKVNLIGVIQVTLSMLPLVRRARGRIVNVSSILGRVAFFVGGYCVSKYGVEAFSDILRREIQHFGVKISIVEPGYFRTGMTNMTQSLERMKQSWKEAPKHIKETYGQQYFDALYNIMKEGLLNCSTNLNLVTDCMEHALTSVHPRTRYSAGWDAKFFFIPLSYLPTSLADYILTRSWPKPAQAV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HSD17B6 hydroxysteroid (17-beta) dehydrogenase 6 homolog (mouse) [ Homo sapiens ] |
Official Symbol | HSD17B6 |
Synonyms | HSD17B6; hydroxysteroid (17-beta) dehydrogenase 6 homolog (mouse); hydroxysteroid (17 beta) dehydrogenase 6; 17-beta-hydroxysteroid dehydrogenase type 6; 3(alpha >beta) hydroxysteroid epimerasel; 3 hydroxysteroid epimerase; HSE; NAD+ dependent 3 alpha hydroxysteroid dehydrogenase; oxidative 3 alpha hydroxysteroid dehydrogenase; oxidoreductase; retinol dehydrogenase; RODH; SDR9C6; short chain dehydrogenase/reductase family 9C; member 6; 17-beta-HSD6; 17-beta-HSD 6; 3-alpha-> beta-HSE; 3-hydroxysteroid epimerase; beta-hydroxysteroid epimerase; 3(alpha-> beta)-hydroxysteroid epimerase; beta)-hydroxysteroid epimerasel; oxidative 3-alpha hydroxysteroid dehydrogenase; oxidative 3-alpha-hydroxysteroid-dehydrogenase; short chain dehydrogenase/reductase family 9C, member 6; NAD+ -dependent 3 alpha-hydroxysteroid dehydrogenase 3-hydroxysteroid epimerase; |
Gene ID | 8630 |
mRNA Refseq | NM_003725 |
Protein Refseq | NP_003716 |
MIM | 606623 |
UniProt ID | O14756 |
◆ Recombinant Proteins | ||
HSD17B6-2929R | Recombinant Rat HSD17B6 Protein | +Inquiry |
HSD17B6-3872HF | Recombinant Full Length Human HSD17B6 Protein, GST-tagged | +Inquiry |
HSD17B6-2156R | Recombinant Rhesus monkey HSD17B6 Protein, His-tagged | +Inquiry |
HSD17B6-13961H | Recombinant Human HSD17B6, GST-tagged | +Inquiry |
HSD17B6-4337M | Recombinant Mouse HSD17B6 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSD17B6-5372HCL | Recombinant Human HSD17B6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HSD17B6 Products
Required fields are marked with *
My Review for All HSD17B6 Products
Required fields are marked with *
0
Inquiry Basket