Recombinant Full Length Human HSDL2 Protein, C-Flag-tagged
Cat.No. : | HSDL2-1485HFL |
Product Overview : | Recombinant Full Length Human HSDL2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Predicted to enable oxidoreductase activity. Located in mitochondrion and peroxisome. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 45.2 kDa |
AA Sequence : | MLPNTGRLAGCTVFITGASRGIGKAIALKAAKDGANIVIAAKTAQPHPKLLGTIYTAAEEIEAVGGKALP CIVDVRDEQQISAAVEKAIKKFGGIDILVNNASAISLTNTLDTPTKRLDLMMNVNTRGTYLASKACIPYL KKSKVAHILNISPPLNLNPVWFKQHCAYTIAKYGMSMYVLGMAEEFKGEIAVNALWPKTAIHTAAMDMLG GPGIESQCRKVDIIADAAYSIFQKPKSFTGNFVIDENILKEEGIENFDVYAIKPGHPLQPDFFLDEYPEA VSKKVESTGAVPEFKEEKLQLQPKPRSGAVEETFRIVKDSLSDDVVKATQAIYLFELSGEDGGTWFLDLK SKGGNVGYGEPSDQADVVMSMTTDDFVKMFSGKLKPTMAFMSGKLKIKGNMALAIKLEKLMNQMNARLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | HSDL2 hydroxysteroid dehydrogenase like 2 [ Homo sapiens (human) ] |
Official Symbol | HSDL2 |
Synonyms | C9orf99; SDR13C1 |
Gene ID | 84263 |
mRNA Refseq | NM_032303.5 |
Protein Refseq | NP_115679.2 |
UniProt ID | Q6YN16 |
◆ Recombinant Proteins | ||
HSDL2-3886HF | Recombinant Full Length Human HSDL2 Protein, GST-tagged | +Inquiry |
HSDL2-2128H | Recombinant Human HSDL2 Protein, MYC/DDK-tagged | +Inquiry |
HSDL2-694H | Recombinant Human HSDL2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HSDL2-1485HFL | Recombinant Full Length Human HSDL2 Protein, C-Flag-tagged | +Inquiry |
HSDL2-4345M | Recombinant Mouse HSDL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSDL2-820HCL | Recombinant Human HSDL2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSDL2 Products
Required fields are marked with *
My Review for All HSDL2 Products
Required fields are marked with *