Recombinant Full Length Human HSFX1 Protein, GST-tagged

Cat.No. : HSFX1-6223HF
Product Overview : Human LW-1 full-length ORF ( AAH21706, 1 a.a. - 423 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 423 amino acids
Description : HSFX1 (Heat Shock Transcription Factor Family, X-Linked 1) is a Protein Coding gene. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and sequence-specific DNA binding. An important paralog of this gene is HSFX2.
Molecular Mass : 72.27 kDa
AA Sequence : MEDKRSLSMARCEERNSRGQDHGLERVPFPPQLQSETYLHPADPSPAWDDPGSTGSPNLRLLTEEIAFQPLAEEASFRRPHPDGDVPPQGEDNLLSLPFPQKLWRLVSSNQFSSIWWDDSGACRVINQKLFEKEILKRDVAHKVFATTSIKSFFRQLNLYGFRKRRQCTFRTFTRIFSAKRLVSILNKLEFYCHPYFQRDSPHLLVRMKRRVGVKSAPRHQEEDKPEAAGSCLAPADTEQQDHTSPNENDQVTPQHREPAGPNTQIRSGSAPPATPVMVPDSAVASDNSPVTQPAGEWSEGSQAHVTPVAAVPGPAALPFLYVPGSPTQMNSYGPVVALPTASRSTLAMDTTGLPAPGMLPFCHLWVPVTLVAAGAAQPAASMVMFPHLPALHHHCPHSHRTSQYMPASDGPQAYPDYADQST
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HSFX1 heat shock transcription factor family, X linked 1 [ Homo sapiens ]
Official Symbol HSFX1
Synonyms HSFX1; heat shock transcription factor family, X linked 1; heat shock transcription factor, X-linked; LW 1; LW-1; HSFX2; FLJ17347; MGC26102;
Gene ID 100506164
mRNA Refseq NM_016153
Protein Refseq NP_057237
UniProt ID Q9UBD0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HSFX1 Products

Required fields are marked with *

My Review for All HSFX1 Products

Required fields are marked with *

0
cart-icon