Recombinant Full Length Human HSFX1 Protein, GST-tagged
| Cat.No. : | HSFX1-6223HF |
| Product Overview : | Human LW-1 full-length ORF ( AAH21706, 1 a.a. - 423 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 423 amino acids |
| Description : | HSFX1 (Heat Shock Transcription Factor Family, X-Linked 1) is a Protein Coding gene. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and sequence-specific DNA binding. An important paralog of this gene is HSFX2. |
| Molecular Mass : | 72.27 kDa |
| AA Sequence : | MEDKRSLSMARCEERNSRGQDHGLERVPFPPQLQSETYLHPADPSPAWDDPGSTGSPNLRLLTEEIAFQPLAEEASFRRPHPDGDVPPQGEDNLLSLPFPQKLWRLVSSNQFSSIWWDDSGACRVINQKLFEKEILKRDVAHKVFATTSIKSFFRQLNLYGFRKRRQCTFRTFTRIFSAKRLVSILNKLEFYCHPYFQRDSPHLLVRMKRRVGVKSAPRHQEEDKPEAAGSCLAPADTEQQDHTSPNENDQVTPQHREPAGPNTQIRSGSAPPATPVMVPDSAVASDNSPVTQPAGEWSEGSQAHVTPVAAVPGPAALPFLYVPGSPTQMNSYGPVVALPTASRSTLAMDTTGLPAPGMLPFCHLWVPVTLVAAGAAQPAASMVMFPHLPALHHHCPHSHRTSQYMPASDGPQAYPDYADQST |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HSFX1 heat shock transcription factor family, X linked 1 [ Homo sapiens ] |
| Official Symbol | HSFX1 |
| Synonyms | HSFX1; heat shock transcription factor family, X linked 1; heat shock transcription factor, X-linked; LW 1; LW-1; HSFX2; FLJ17347; MGC26102; |
| Gene ID | 100506164 |
| mRNA Refseq | NM_016153 |
| Protein Refseq | NP_057237 |
| UniProt ID | Q9UBD0 |
| ◆ Recombinant Proteins | ||
| HSFX1-4574H | Recombinant Human HSFX1 Protein, GST-tagged | +Inquiry |
| HSFX1-2124H | Recombinant Human HSFX1 Protein, GST/His-tagged | +Inquiry |
| HSFX1-6223HF | Recombinant Full Length Human HSFX1 Protein, GST-tagged | +Inquiry |
| HSFX1-2126H | Recombinant Human HSFX1 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HSFX1-5364HCL | Recombinant Human HSFX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSFX1 Products
Required fields are marked with *
My Review for All HSFX1 Products
Required fields are marked with *
