Recombinant Full Length Human HSPA14 Protein, C-Flag-tagged
Cat.No. : | HSPA14-1312HFL |
Product Overview : | Recombinant Full Length Human HSPA14 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Predicted to enable several functions, including ATP binding activity; misfolded protein binding activity; and unfolded protein binding activity. Predicted to be involved in several processes, including cellular response to unfolded protein; chaperone cofactor-dependent protein refolding; and protein refolding. Located in cytosol. Colocalizes with ribosome. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 54.6 kDa |
AA Sequence : | MAAIGVHLGCTSACVAVYKDGRAGVVANDAGDRVTPAVVAYSENEEIVGLAAKQSRIRNISNTVMKVKQI LGRSSSDPQAQKYIAESKCLVIEKNGKLRYEIDTGEETKFVNPEDVARLIFSKMKETAHSVLGSDANDVV ITVPFDFGEKQKNALGEAARAAGFNVLRLIHEPSAALLAYGIGQDSPTGKSNILVFKLGGTSLSLSVMEV NSGIYRVLSTNTDDNIGGAHFTETLAQYLASEFQRSFKHDVRGNARAMMKLTNSAEVAKHSLSTLGSANC FLDSLYEGQDFDCNVSRARFELLCSPLFNKCIEAIRGLLDQNGFTADDINKVVLCGGSSRIPKLQQLIKD LFPAVELLNSIPPDEVIPIGAAIEAGILIGKENLLVEDSLMIECSARDILVKGVDESGASRFTVLFPSGT PLPARRQHTLQAPGSISSVCLELYESDGKNSAKEETKFAQVVLQDLDKKENGLRDILAVLTMKRDGSLHV TCTDQETGKCEAISIEIASTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Stem cell - Pluripotency |
Full Length : | Full L. |
Gene Name | HSPA14 heat shock protein family A (Hsp70) member 14 [ Homo sapiens (human) ] |
Official Symbol | HSPA14 |
Synonyms | HSP70-4; HSP70L1; MSANTD7 |
Gene ID | 51182 |
mRNA Refseq | NM_016299.4 |
Protein Refseq | NP_057383.2 |
MIM | 610369 |
UniProt ID | Q0VDF9 |
◆ Recombinant Proteins | ||
HSPA14-1985R | Recombinant Rhesus Macaque HSPA14 Protein, His (Fc)-Avi-tagged | +Inquiry |
Hspa14-23HCL | Recombinant Mouse Hspa14 overexpression lysate | +Inquiry |
HSPA14-3537H | Recombinant Human HSPA14 Protein (Met1-Ser509), N-His tagged | +Inquiry |
HSPA14-1116H | Recombinant Human HSPA14 Protein, His (Fc)-Avi-tagged | +Inquiry |
HSPA14-499H | Recombinant Human HSPA14 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSPA14-5357HCL | Recombinant Human HSPA14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSPA14 Products
Required fields are marked with *
My Review for All HSPA14 Products
Required fields are marked with *
0
Inquiry Basket