Recombinant Full Length Human HSPA9 Protein, C-Flag-tagged
Cat.No. : | HSPA9-477HFL |
Product Overview : | Recombinant Full Length Human HSPA9 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the heat shock protein 70 gene family. The encoded protein is primarily localized to the mitochondria but is also found in the endoplasmic reticulum, plasma membrane and cytoplasmic vesicles. This protein is a heat-shock cognate protein. This protein plays a role in cell proliferation, stress response and maintenance of the mitochondria. A pseudogene of this gene is found on chromosome 2. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 73.5 kDa |
AA Sequence : | MISASRAAAARLVGAAASRGPTAARHQDSWNGLSHEAFRLVSRRDYASEAIKGAVVGIDLGTTNSCVAVM EGKRAKVLENAEGARTTPSVVAFTADGERLVGMPAKRQAVTNPNNTFYATKRLIGRRYDDPEVQKDIKNV PFKIVRASNGDAWVEAHGKLYSPSQIGAFVLMKMKETAENYLGRTAKNAVITVPAYFNDSQRQATKDAGQ ISGLNVLRVINEPTAAALAYGLDKSEDKVIAVYDLGGGTFDISILEIQKGVFEVKSTNGDTFLGGEDFDQ ALLRHIVKEFKRETGVDLTKDNMALQRVREAAEKAKCELSSSVQTDINLPYLTMDSSGPKHLNMKLTRAQ FEGIVTDLIRRTIAPCQKAMQDAEVSKSDIGEVILVGGMTRMPKVQQTVQDLFGRAPSKAVNPDEAVAIG AAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVCQGE REMAGDNKLLGQFTLIGIPPAPRGVPQIEVTFDIDANGIVHVSAKDKGTGREQQIVIQSSGGLSKDDIEN MVKNAEKYAEEDRRKKERVEAVNMAEGIIHDTETKMEEFKDQLPADECNKLKEEISKMRELLARKDSETG ENIRQAASSLQQASLKLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Stem cell - Pluripotency |
Protein Pathways : | RNA degradation |
Full Length : | Full L. |
Gene Name | HSPA9 heat shock protein family A (Hsp70) member 9 [ Homo sapiens (human) ] |
Official Symbol | HSPA9 |
Synonyms | CSA; MOT; MOT2; SAAN; CRP40; EVPLS; GRP75; PBP74; GRP-75; HSPA9B; SIDBA4; MTHSP75; HEL-S-124m |
Gene ID | 3313 |
mRNA Refseq | NM_004134.7 |
Protein Refseq | NP_004125.3 |
MIM | 600548 |
UniProt ID | P38646 |
◆ Recombinant Proteins | ||
Hspa9-1192M | Recombinant Mouse Hspa9 Protein, MYC/DDK-tagged | +Inquiry |
HSPA9-334H | Recombinant Human Heat Shock 70kDa Protein 9 (Mortalin), His-tagged | +Inquiry |
HSPA9-5113H | Recombinant Human HSPA9 Protein, GST-tagged | +Inquiry |
HSPA9-29142TH | Recombinant Human HSPA9, His-tagged | +Inquiry |
HSPA9-4359M | Recombinant Mouse HSPA9 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSPA9-5352HCL | Recombinant Human HSPA9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSPA9 Products
Required fields are marked with *
My Review for All HSPA9 Products
Required fields are marked with *
0
Inquiry Basket