Recombinant Full Length Human HSPB9 Protein, GST-tagged

Cat.No. : HSPB9-3970HF
Product Overview : Human HSPB9 full-length ORF ( NP_149971.1, 1 a.a. - 159 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 159 amino acids
Description : HSPB9 (Heat Shock Protein Family B (Small) Member 9) is a Protein Coding gene.
Molecular Mass : 43.9 kDa
AA Sequence : MQRVGNTFSNESRVASRCPSVGLAERNRVATMPVRLLRDSPAAQEDNDHARDGFQMKLDAHGFAPEELVVQVDGQWLMVTGQQQLDVRDPERVSYRMSQKVHRKMLPSNLSPTAMTCCLTPSGQLWVRGQCVALALPEAQTGPSPRLGSLGSKASNLTR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HSPB9 heat shock protein, alpha-crystallin-related, B9 [ Homo sapiens ]
Official Symbol HSPB9
Synonyms HSPB9; heat shock protein, alpha-crystallin-related, B9; heat shock protein beta-9; cancer/testis antigen 51; CT51; small heat shock protein B9; FLJ27437;
Gene ID 94086
mRNA Refseq NM_033194
Protein Refseq NP_149971
MIM 608344
UniProt ID Q9BQS6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HSPB9 Products

Required fields are marked with *

My Review for All HSPB9 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon