Recombinant Full Length Human HTR1E Protein

Cat.No. : HTR1E-5678HF
Product Overview : Human HTR1E full-length ORF (NP_000856.1) recombinant protein without tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 404 amino acids
Description : HTR1E (5-Hydroxytryptamine Receptor 1E) is a Protein Coding gene. Diseases associated with HTR1E include Attention Deficit-Hyperactivity Disorder. Among its related pathways are Serotonergic synapse and Peptide ligand-binding receptors. GO annotations related to this gene include G-protein coupled receptor activity and serotonin binding. An important paralog of this gene is HTR1F.
Form : Liquid
Molecular Mass : 41.7 kDa
AA Sequence : MNITNCTTEASMAIRPKTITEKMLICMTLVVITTLTTLLNLAVIMAIGTTKKLHQPANYLICSLAVTDLLVAVLVMPLSIIYIVMDRWKLGYFLCEVWLSVDMTCCTCSILHLCVIALDRYWAITNAIEYARKRTAKRAALMILTVWTISIFISMPPLFWRSHRRLSPPPSQCTIQHDHVIYTIYSTLGAFYIPLTLILILYYRIYHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKLTQTFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLDHPGERQQISSTRERKAARILGLILGAFILSWLPFFIKELIVGLSIYTVSSEVADFLTWLGYVNSLINPLLYTSFNEDFKLAFKKLIRCREHT
Applications : Antibody Production
Functional Study
Compound Screening
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene Name HTR1E 5-hydroxytryptamine (serotonin) receptor 1E, G protein-coupled [ Homo sapiens ]
Official Symbol HTR1E
Synonyms HTR1E; 5-hydroxytryptamine (serotonin) receptor 1E, G protein-coupled; 5 hydroxytryptamine (serotonin) receptor 1E; 5-hydroxytryptamine receptor 1E; 5 HT1E; S31; 5-HT-1E; serotonin receptor 1E; 5-HT1E;
Gene ID 3354
mRNA Refseq NM_000865
Protein Refseq NP_000856
MIM 182132
UniProt ID P28566

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HTR1E Products

Required fields are marked with *

My Review for All HTR1E Products

Required fields are marked with *

0

Inquiry Basket

cartIcon