Recombinant Human HTR1E Protein
| Cat.No. : | HTR1E-5248H |
| Product Overview : | Human HTR1E full-length ORF (NP_000856.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Description : | HTR1E (5-Hydroxytryptamine Receptor 1E) is a Protein Coding gene. Diseases associated with HTR1E include Attention Deficit-Hyperactivity Disorder. Among its related pathways are Serotonergic synapse and Peptide ligand-binding receptors. GO annotations related to this gene include G-protein coupled receptor activity and serotonin binding. An important paralog of this gene is HTR1F. |
| Form : | Liquid |
| Molecular Mass : | 41.7 kDa |
| AA Sequence : | MNITNCTTEASMAIRPKTITEKMLICMTLVVITTLTTLLNLAVIMAIGTTKKLHQPANYLICSLAVTDLLVAVLVMPLSIIYIVMDRWKLGYFLCEVWLSVDMTCCTCSILHLCVIALDRYWAITNAIEYARKRTAKRAALMILTVWTISIFISMPPLFWRSHRRLSPPPSQCTIQHDHVIYTIYSTLGAFYIPLTLILILYYRIYHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKLTQTFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLDHPGERQQISSTRERKAARILGLILGAFILSWLPFFIKELIVGLSIYTVSSEVADFLTWLGYVNSLINPLLYTSFNEDFKLAFKKLIRCREHT |
| Applications : | Antibody Production Functional Study Compound Screening |
| Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Gene Name | HTR1E 5-hydroxytryptamine (serotonin) receptor 1E, G protein-coupled [ Homo sapiens ] |
| Official Symbol | HTR1E |
| Synonyms | HTR1E; 5-hydroxytryptamine (serotonin) receptor 1E, G protein-coupled; 5 hydroxytryptamine (serotonin) receptor 1E; 5-hydroxytryptamine receptor 1E; 5 HT1E; S31; 5-HT-1E; serotonin receptor 1E; 5-HT1E; |
| Gene ID | 3354 |
| mRNA Refseq | NM_000865 |
| Protein Refseq | NP_000856 |
| MIM | 182132 |
| UniProt ID | P28566 |
| ◆ Recombinant Proteins | ||
| HTR1E-5678HF | Recombinant Full Length Human HTR1E Protein | +Inquiry |
| HTR1E-5247H | Recombinant Human HTR1E Protein, GST-tagged | +Inquiry |
| RFL27491PF | Recombinant Full Length Pan Troglodytes 5-Hydroxytryptamine Receptor 1E(Htr1E) Protein, His-Tagged | +Inquiry |
| RFL10440SF | Recombinant Full Length Pig 5-Hydroxytryptamine Receptor 1E(Htr1E) Protein, His-Tagged | +Inquiry |
| HTR1E-5248H | Recombinant Human HTR1E Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HTR1E-5336HCL | Recombinant Human HTR1E 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HTR1E Products
Required fields are marked with *
My Review for All HTR1E Products
Required fields are marked with *
