Recombinant Full Length Human Hydroxycarboxylic Acid Receptor 1(Hcar1) Protein, His-Tagged
Cat.No. : | RFL3471HF |
Product Overview : | Recombinant Full Length Human Hydroxycarboxylic acid receptor 1(HCAR1) Protein (Q9BXC0) (1-346aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-346) |
Form : | Lyophilized powder |
AA Sequence : | MYNGSCCRIEGDTISQVMPPLLIVAFVLGALGNGVALCGFCFHMKTWKPSTVYLFNLAVA DFLLMICLPFRTDYYLRRRHWAFGDIPCRVGLFTLAMNRAGSIVFLTVVAADRYFKVVHP HHAVNTISTRVAAGIVCTLWALVILGTVYLLLENHLCVQETAVSCESFIMESANGWHDIM FQLEFFMPLGIILFCSFKIVWSLRRRQQLARQARMKKATRFIMVVAIVFITCYLPSVSAR LYFLWTVPSSACDPSVHGALHITLSFTYMNSMLDPLVYYFSSPSFPKFYNKLKICSLKPK QPGHSKTQRPEEMPISNLGRRSCISVANSFQSQSDGQWDPHIVEWH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HCAR1 |
Synonyms | HCAR1; GPR104; GPR81; HCA1; FKSG80; Hydroxycarboxylic acid receptor 1; G-protein coupled receptor 104; G-protein coupled receptor 81 |
UniProt ID | Q9BXC0 |
◆ Recombinant Proteins | ||
HCAR1-5641HF | Recombinant Full Length Human HCAR1 Protein | +Inquiry |
HCAR1-527H | Recombinant Human HCAR1 Full Length protein(VLPs) | +Inquiry |
HCAR1-2047R | Recombinant Rhesus monkey HCAR1 Protein, His-tagged | +Inquiry |
HCAR1-5268H | Recombinant Human HCAR1 Protein, GST-tagged | +Inquiry |
HCAR1-2232H | Recombinant Human HCAR1 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HCAR1 Products
Required fields are marked with *
My Review for All HCAR1 Products
Required fields are marked with *
0
Inquiry Basket