Recombinant Full Length Human Hydroxycarboxylic Acid Receptor 3(Hcar3) Protein, His-Tagged
Cat.No. : | RFL20598HF |
Product Overview : | Recombinant Full Length Human Hydroxycarboxylic acid receptor 3(HCAR3) Protein (P49019) (1-387aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-387) |
Form : | Lyophilized powder |
AA Sequence : | MNRHHLQDHFLEIDKKNCCVFRDDFIAKVLPPVLGLEFIFGLLGNGLALWIFCFHLKSWK SSRIFLFNLAVADFLLIICLPFVMDYYVRRSDWKFGDIPCRLVLFMFAMNRQGSIIFLTV VAVDRYFRVVHPHHALNKISNWTAAIISCLLWGITVGLTVHLLKKKLLIQNGPANVCISF SICHTFRWHEAMFLLEFLLPLGIILFCSARIIWSLRQRQMDRHAKIKRAITFIMVVAIVF VICFLPSVVVRIRIFWLLHTSGTQNCEVYRSVDLAFFITLSFTYMNSMLDPVVYYFSSPS FPNFFSTLINRCLQRKMTGEPDNNRSTSVELTGDPNKTRGAPEALMANSGEPWSPSYLGP TSNNHSKKGHCHQEPASLEKQLGCCIE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HCAR3 |
Synonyms | HCAR3; GPR109B; HCA3; HM74B; NIACR2; Hydroxycarboxylic acid receptor 3; G-protein coupled receptor 109B; G-protein coupled receptor HM74; G-protein coupled receptor HM74B; Niacin receptor 2; Nicotinic acid receptor 2 |
UniProt ID | P49019 |
◆ Recombinant Proteins | ||
HCAR3-5168H | Recombinant Human HCAR3 Protein, GST-tagged | +Inquiry |
HCAR3-5565HF | Recombinant Full Length Human HCAR3 Protein, GST-tagged | +Inquiry |
RFL20598HF | Recombinant Full Length Human Hydroxycarboxylic Acid Receptor 3(Hcar3) Protein, His-Tagged | +Inquiry |
HCAR3-5167H | Recombinant Human HCAR3 Protein | +Inquiry |
HCAR3-5563HF | Recombinant Full Length Human HCAR3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HCAR3-737HCL | Recombinant Human HCAR3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HCAR3 Products
Required fields are marked with *
My Review for All HCAR3 Products
Required fields are marked with *
0
Inquiry Basket