Recombinant Full Length Human HYKK Protein, GST-tagged
Cat.No. : | HYKK-5730HF |
Product Overview : | Human HYKK full-length ORF ( ENSP00000353710, 1 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 172 amino acids |
Description : | HYKK (Hydroxylysine Kinase) is a Protein Coding gene. Diseases associated with HYKK include Nicotine Dependence, Protection Against. Among its related pathways are Lysine degradation and Viral mRNA Translation. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and hydroxylysine kinase activity. |
Molecular Mass : | 45.2 kDa |
AA Sequence : | MSSGNYQQSEALSKPTFSEEQASALVESVFGLKVSKVRPLPSYDDQNFHVYVSKTKDGPTEYVLKISNTKASKNPDLIEVQNHIIMFLKAAGFPTASVCHTKGDNTASLVSVDSGSEIKSYLVRLLTYLPGRPIAELPVSPQLLYEIGKLAAKLDKTLQEGKPRVTPLLAKN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HYKK hydroxylysine kinase [ Homo sapiens (human) ] |
Official Symbol | HYKK |
Synonyms | HYKK; hydroxylysine kinase; AGPHD1; Hydroxylysine Kinase; Aminoglycoside Phosphotransferase Domain-Containing Protein 1; 5-Hydroxy-L-Lysine Kinase; 5-Hydroxylysine Kinase; Aminoglycoside Phosphotransferase Domain Containing 1; EC 2.7.1.81; hydroxylysine kinase; 5-hydroxy-L-lysine kinase; 5-hydroxylysine kinase; aminoglycoside phosphotransferase domain-containing protein 1 |
Gene ID | 123688 |
mRNA Refseq | NM_001013619 |
Protein Refseq | NP_001013641 |
MIM | 614681 |
UniProt ID | A2RU49 |
◆ Recombinant Proteins | ||
Hykk-3464M | Recombinant Mouse Hykk Protein, Myc/DDK-tagged | +Inquiry |
hykk-4291Z | Recombinant Zebrafish hykk protein, His-SUMO & Myc-tagged | +Inquiry |
HYKK-2383H | Recombinant Human HYKK Protein, MYC/DDK-tagged | +Inquiry |
HYKK-2736H | Recombinant Human HYKK Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HYKK-4857C | Recombinant Chicken HYKK | +Inquiry |
◆ Cell & Tissue Lysates | ||
HYKK-387HCL | Recombinant Human HYKK lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HYKK Products
Required fields are marked with *
My Review for All HYKK Products
Required fields are marked with *