Recombinant Full Length Human HYOU1 Protein, GST-tagged

Cat.No. : HYOU1-5744HF
Product Overview : Human HYOU1 full-length ORF ( AAH04560.1, 36 a.a. - 147 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 36-147 amino acids
Description : The protein encoded by this gene belongs to the heat shock protein 70 family. This gene uses alternative transcription start sites. A cis-acting segment found in the 5 UTR is involved in stress-dependent induction, resulting in the accumulation of this protein in the endoplasmic reticulum (ER) under hypoxic conditions. The protein encoded by this gene is thought to play an important role in protein folding and secretion in the ER. Since suppression of the protein is associated with accelerated apoptosis, it is also suggested to have an important cytoprotective role in hypoxia-induced cellular perturbation. This protein has been shown to be up-regulated in tumors, especially in breast tumors, and thus it is associated with tumor invasiveness. This gene also has an alternative translation initiation site, resulting in a protein that lacks the N-terminal signal peptide. This signal peptide-lacking protein, which is only 3 amino acids shorter than the mature protein in the ER, is thought to have a housekeeping function in the cytosol. In rat, this protein localizes to both the ER by a carboxy-terminal peptide sequence and to mitochondria by an amino-terminal targeting signal. [provided by RefSeq
Molecular Mass : 38.06 kDa
AA Sequence : MSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTLKENERFFGDSAASMAIKNPKATLRYFQHLLGKQADNPHVALYQARFPEHELTFDPQRQTVHFQISSQLQFSPL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HYOU1 hypoxia up-regulated 1 [ Homo sapiens ]
Official Symbol HYOU1
Synonyms HYOU1; hypoxia up-regulated 1; hypoxia up-regulated protein 1; glucose regulated protein 170; Grp170; HSP12A; ORP150; glucose-regulated protein 170; 150 kDa oxygen-regulated protein; oxygen regulated protein (150kD); 170 kDa glucose-regulated protein; GRP-170; ORP-150; FLJ94899; FLJ97572; DKFZp686N08236;
Gene ID 10525
mRNA Refseq NM_001130991
Protein Refseq NP_001124463
MIM 601746
UniProt ID Q9Y4L1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HYOU1 Products

Required fields are marked with *

My Review for All HYOU1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon