Recombinant Full Length Human ICAM4 Protein, C-Flag-tagged
Cat.No. : | ICAM4-1357HFL |
Product Overview : | Recombinant Full Length Human ICAM4 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes the Landsteiner-Wiener (LW) blood group antigen(s) that belongs to the immunoglobulin (Ig) superfamily, and that shares similarity with the intercellular adhesion molecule (ICAM) protein family. This ICAM protein contains 2 Ig-like C2-type domains and binds to the leukocyte adhesion LFA-1 protein. The molecular basis of the LW(A)/LW(B) blood group antigens is a single aa variation at position 100; Gln-100=LW(A) and Arg-100=LW(B). Alternative splicing results in multiple transcript variants encoding distinct isoforms. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 27.4 kDa |
AA Sequence : | MGSLFPLSLLFFLAAAYPGVGSALGRRTKRAQSPKGSPLAPSGTSVPFWVRMSPEFVAVQPGKSVQLNCS NSCPQPQNSSLRTPLRQGKTLRGPGWVSYQLLDVRAWSSLAHCLVTCAGKTRWATSRITAYSVPGGLLGG DPEAWKPGHLFRKPGALHRPGSGQRDLDLRVCCWTPRLLAARDLPRAPQSRRPGGPQQLGTHYTDARLEP RAHSFGLRFHRCPCRDPPHCGRCVPMQVPSYEVPGVKGDVLCRLSEKKRNMKQSGEMAIHGGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Secreted Protein, Transmembrane |
Full Length : | Full L. |
Gene Name | ICAM4 intercellular adhesion molecule 4 (Landsteiner-Wiener blood group) [ Homo sapiens (human) ] |
Official Symbol | ICAM4 |
Synonyms | LW; CD242 |
Gene ID | 3386 |
mRNA Refseq | NM_001039132.3 |
Protein Refseq | NP_001034221.1 |
MIM | 614088 |
UniProt ID | Q14773 |
◆ Recombinant Proteins | ||
Icam4-3469M | Recombinant Mouse Icam4 Protein, Myc/DDK-tagged | +Inquiry |
Icam4-7129R | Recombinant Rat Icam4 protein, His & T7-tagged | +Inquiry |
ICAM4-204H | Recombinant Human ICAM4 Protein, GST-His-tagged | +Inquiry |
ICAM4-1255H | Recombinant Human ICAM4 Protein (Met52-Trp234), N-His tagged | +Inquiry |
ICAM4-1621R | Recombinant Rhesus Monkey ICAM4 Protein, hIgG4-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ICAM4-943HCL | Recombinant Human ICAM4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ICAM4 Products
Required fields are marked with *
My Review for All ICAM4 Products
Required fields are marked with *
0
Inquiry Basket