Recombinant Full Length Human IDH3A Protein, C-Flag-tagged
Cat.No. : | IDH3A-1349HFL |
Product Overview : | Recombinant Full Length Human IDH3A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. NAD(+)-dependent isocitrate dehydrogenases catalyze the allosterically regulated rate-limiting step of the tricarboxylic acid cycle. Each isozyme is a heterotetramer that is composed of two alpha subunits, one beta subunit, and one gamma subunit. The protein encoded by this gene is the alpha subunit of one isozyme of NAD(+)-dependent isocitrate dehydrogenase. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 36.6 kDa |
AA Sequence : | MAGPAWISKVSRLLGAFHNPKQVTRGFTGGVQTVTLIPGDGIGPEISAAVMKIFDAAKAPIQWEERNVTA IQGPGGKWMIPSEAKESMDKNKMGLKGPLKTPIAAGHPSMNLLLRKTFDLYANVRPCVSIEGYKTPYTDV NIVTIRENTEGEYSGIEHVIVDGVVQSIKLITEGASKRIAEFAFEYARNNHRSNVTAVHKANIMRMSDGL FLQKCREVAESCKDIKFNEMYLDTVCLNMVQDPSQFDVLVMPNLYGDILSDLCAGLIGGLGVTPSGNIGA NGVAIFESVHGTAPDIAGKDMANPTALLLSAVMMLRHMGLFDHAARIEAACFATIKDGKSLTKDLGGNAK CSDFTEEICRRVKDLDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Citrate cycle (TCA cycle), Metabolic pathways |
Full Length : | Full L. |
Gene Name | IDH3A isocitrate dehydrogenase (NAD(+)) 3 catalytic subunit alpha [ Homo sapiens (human) ] |
Official Symbol | IDH3A |
Synonyms | RP90 |
Gene ID | 3419 |
mRNA Refseq | NM_005530.3 |
Protein Refseq | NP_005521.1 |
MIM | 601149 |
UniProt ID | P50213 |
◆ Recombinant Proteins | ||
IDH3A-28925TH | Recombinant Human IDH3A | +Inquiry |
IDH3A-1349HFL | Recombinant Full Length Human IDH3A Protein, C-Flag-tagged | +Inquiry |
IDH3A-1255C | Recombinant Chicken IDH3A | +Inquiry |
IDH3A-11188Z | Recombinant Zebrafish IDH3A | +Inquiry |
Idh3a-3473M | Recombinant Mouse Idh3a Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IDH3A-5305HCL | Recombinant Human IDH3A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IDH3A Products
Required fields are marked with *
My Review for All IDH3A Products
Required fields are marked with *
0
Inquiry Basket