Recombinant Full Length Human IDH3G Protein
| Cat.No. : | IDH3G-252HF |
| Product Overview : | Recombinant full length Human IDH3G with N terminal proprietary tag; Predicted MWt 69.34 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 393 amino acids |
| Description : | Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. NAD(+)-dependent isocitrate dehydrogenases catalyze the allosterically regulated rate-limiting step of the tricarboxylic acid cycle. Each isozyme is a heterotetramer that is composed of two alpha subunits, one beta subunit, and one gamma subunit. The protein encoded by this gene is the gamma subunit of one isozyme of NAD(+)-dependent isocitrate dehydrogenase. This gene is a candidate gene for periventricular heterotopia. Several alternatively spliced transcript variants of this gene have been described, but only some of their full length natures have been determined. |
| Form : | Liquid |
| Molecular Mass : | 69.340kDa inclusive of tags |
| AA Sequence : | MALKVATVAGSAAKAVLGPALLCRPWEVLGAHEVPSRNIF SEQTIPPSAKYGGRHTVTMIPGDGIGPELMLHVKSVFRHA CVPVDFEEVHVSSNADEEDIRNAIMAIRRNRVALKGNIET NHNLPPSHKSRNNILRTSLDLYANVIHCKSLPGVVTRHKD IDILIVRENTEGEYSSLEHESVAGVVESLKIITKAKSLRI AEYAFKLAQESGRKKVTAVHKANIMKLGDGLFLQCCREVA ARYPQITFENMIVDNTTMQLVSRPQQFDVMVMPNLYGNIV NNVCAGLVGGPGLVAGANYGHVYAVFETATRNTGKSIANK NIANPTATLLASCMMLDHLKLHSYAASIRKAVLASMDNEN MHTPDIGGQGTTSEAIQDVIRHIRVINGRAVEA |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name | IDH3G isocitrate dehydrogenase 3 (NAD+) gamma [ Homo sapiens ] |
| Official Symbol | IDH3G |
| Synonyms | IDH3G; isocitrate dehydrogenase 3 (NAD+) gamma; isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial |
| Gene ID | 3421 |
| mRNA Refseq | NM_004135 |
| Protein Refseq | NP_004126 |
| MIM | 300089 |
| UniProt ID | P51553 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IDH3G Products
Required fields are marked with *
My Review for All IDH3G Products
Required fields are marked with *
Recently Viewed
