Recombinant Full Length Human IDH3G Protein
Cat.No. : | IDH3G-252HF |
Product Overview : | Recombinant full length Human IDH3G with N terminal proprietary tag; Predicted MWt 69.34 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 393 amino acids |
Description : | Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. NAD(+)-dependent isocitrate dehydrogenases catalyze the allosterically regulated rate-limiting step of the tricarboxylic acid cycle. Each isozyme is a heterotetramer that is composed of two alpha subunits, one beta subunit, and one gamma subunit. The protein encoded by this gene is the gamma subunit of one isozyme of NAD(+)-dependent isocitrate dehydrogenase. This gene is a candidate gene for periventricular heterotopia. Several alternatively spliced transcript variants of this gene have been described, but only some of their full length natures have been determined. |
Form : | Liquid |
Molecular Mass : | 69.340kDa inclusive of tags |
AA Sequence : | MALKVATVAGSAAKAVLGPALLCRPWEVLGAHEVPSRNIF SEQTIPPSAKYGGRHTVTMIPGDGIGPELMLHVKSVFRHA CVPVDFEEVHVSSNADEEDIRNAIMAIRRNRVALKGNIET NHNLPPSHKSRNNILRTSLDLYANVIHCKSLPGVVTRHKD IDILIVRENTEGEYSSLEHESVAGVVESLKIITKAKSLRI AEYAFKLAQESGRKKVTAVHKANIMKLGDGLFLQCCREVA ARYPQITFENMIVDNTTMQLVSRPQQFDVMVMPNLYGNIV NNVCAGLVGGPGLVAGANYGHVYAVFETATRNTGKSIANK NIANPTATLLASCMMLDHLKLHSYAASIRKAVLASMDNEN MHTPDIGGQGTTSEAIQDVIRHIRVINGRAVEA |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | IDH3G isocitrate dehydrogenase 3 (NAD+) gamma [ Homo sapiens ] |
Official Symbol | IDH3G |
Synonyms | IDH3G; isocitrate dehydrogenase 3 (NAD+) gamma; isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial |
Gene ID | 3421 |
mRNA Refseq | NM_004135 |
Protein Refseq | NP_004126 |
MIM | 300089 |
UniProt ID | P51553 |
◆ Recombinant Proteins | ||
IDH3G-2471Z | Recombinant Zebrafish IDH3G | +Inquiry |
IDH3G-28079TH | Recombinant Human IDH3G | +Inquiry |
IDH3G-28927TH | Recombinant Human IDH3G, His-tagged | +Inquiry |
IDH3G-4412M | Recombinant Mouse IDH3G Protein, His (Fc)-Avi-tagged | +Inquiry |
IDH3G-7988M | Recombinant Mouse IDH3G Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IDH3G-5303HCL | Recombinant Human IDH3G 293 Cell Lysate | +Inquiry |
IDH3G-5302HCL | Recombinant Human IDH3G 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IDH3G Products
Required fields are marked with *
My Review for All IDH3G Products
Required fields are marked with *
0
Inquiry Basket