Recombinant Full Length Human IDI2 Protein, C-Flag-tagged
Cat.No. : | IDI2-2165HFL |
Product Overview : | Recombinant Full Length Human IDI2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene catalyzes the conversion of isopentenyl diphosphate to dimethylallyl diphosphate, which is a precursor for the synthesis of cholesterol and other isoprenoids. This gene, which is a product of an ancestral gene duplication event, encodes a protein that may be involved in the aggregation of alpha-synuclein in the cerebral cortex of patients with Lewy body disease. In addition, segmental copy number gains in this locus have been associated with sporadic amyotrophic lateral sclerosis. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 26.6 kDa |
AA Sequence : | MSDINLDWVDRRQLQRLEEMLIVVDENDKVIGADTKRNCHLNENIEKGLLHRAFSVVLFNTKNRILIQQR SDTKVTFPGYFTDSCSSHPLYNPAELEEKDAIGVRRAAQRRLQAELGIPGEQISPEDIVFMTIYHHKAKS DRIWGEHEICYLLLVRKNVTLNPDPSETKSILYLSQEELWELLEREARGEVKVTPWLRTIAERFLYRWWP HLDDVTPFVELHKIHRV myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Metabolic pathways, Terpenoid backbone biosynthesis |
Full Length : | Full L. |
Gene Name | IDI2 isopentenyl-diphosphate delta isomerase 2 [ Homo sapiens (human) ] |
Official Symbol | IDI2 |
Synonyms | IPPI2 |
Gene ID | 91734 |
mRNA Refseq | NM_033261.3 |
Protein Refseq | NP_150286.1 |
MIM | 615389 |
UniProt ID | Q9BXS1 |
◆ Recombinant Proteins | ||
IDI2-7990M | Recombinant Mouse IDI2 Protein | +Inquiry |
Idi2-3474M | Recombinant Mouse Idi2 Protein, Myc/DDK-tagged | +Inquiry |
IDI2-14053H | Recombinant Human IDI2, GST-tagged | +Inquiry |
IDI2-1710H | Recombinant Human Isopentenyl-Diphosphate Delta Isomerase 2, His-tagged | +Inquiry |
IDI2-3645H | Recombinant Human IDI2 Protein (Met1-Val227), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IDI2-5301HCL | Recombinant Human IDI2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IDI2 Products
Required fields are marked with *
My Review for All IDI2 Products
Required fields are marked with *
0
Inquiry Basket