Recombinant Full Length Human IDNK Protein, GST-tagged

Cat.No. : IDNK-2671HF
Product Overview : Human C9orf103 full-length ORF (NP_001001551.1, 1 a.a. - 141 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 141 amino acids
Description : IDNK (IDNK, Gluconokinase) is a Protein Coding gene. Among its related pathways are Carbon metabolism and Metabolism. GO annotations related to this gene include kinase activity and gluconokinase activity.
Molecular Mass : 42.1 kDa
AA Sequence : MGKGIPLNDQDRIPWLCNLHDILLRDVASGQRVVLACSALKKTYRDILTQGKDGVALKCEESGKEAKQAEMQLLVVHLSGSFEVISGRLLKREGHFMPPELLQSQFETLEPPAAPENFIQISVDKNVSEIIATIMETLKMK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name IDNK IDNK, gluconokinase [ Homo sapiens (human) ]
Official Symbol IDNK
Synonyms IDNK; IDNK, gluconokinase; C9ORF103; chromosome 9 open reading frame 103; C9orf103, chromosome 9 open reading frame 103; bA522I20.2; hGnt; probable gluconokinase; glucokinase-like protein; gluconate kinase; gluconokinase-like protein; idnK, gluconokinase homolog; EC 2.7.1.12
Gene ID 414328
mRNA Refseq NM_001001551
Protein Refseq NP_001001551
MIM 611343
UniProt ID Q5T6J7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IDNK Products

Required fields are marked with *

My Review for All IDNK Products

Required fields are marked with *

0
cart-icon