Recombinant Full Length Human IDNK Protein, GST-tagged

• Cat.No.: IDNK-2671HF
• Product Overview: Human C9orf103 full-length ORF (NP_001001551.1, 1 a.a. - 141 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 141 amino acids
• Description: IDNK (IDNK, Gluconokinase) is a Protein Coding gene. Among its related pathways are Carbon metabolism and Metabolism. GO annotations related to this gene include kinase activity and gluconokinase activity.
• Molecular Mass: 42.1 kDa
• AA Sequence: MGKGIPLNDQDRIPWLCNLHDILLRDVASGQRVVLACSALKKTYRDILTQGKDGVALKCEESGKEAKQAEMQLLVVHLSGSFEVISGRLLKREGHFMPPELLQSQFETLEPPAAPENFIQISVDKNVSEIIATIMETLKMK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: IDNK IDNK, gluconokinase [ Homo sapiens (human) ]
• Official Symbol: IDNK
• Synonyms: IDNK; IDNK, gluconokinase; C9ORF103; chromosome 9 open reading frame 103; C9orf103, chromosome 9 open reading frame 103; bA522I20.2; hGnt; probable gluconokinase; glucokinase-like protein; gluconate kinase; gluconokinase-like protein; idnK, gluconokinase homolog; EC 2.7.1.12
• Gene ID: 414328
• mRNA Refseq: NM_001001551
• Protein Refseq: NP_001001551
• MIM: 611343
• UniProt ID: Q5T6J7