Recombinant Full Length Human IDUA Protein, C-Flag-tagged
| Cat.No. : | IDUA-458HFL |
| Product Overview : | Recombinant Full Length Human IDUA Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | This gene encodes an enzyme that hydrolyzes the terminal alpha-L-iduronic acid residues of two glycosaminoglycans, dermatan sulfate and heparan sulfate. This hydrolysis is required for the lysosomal degradation of these glycosaminoglycans. Mutations in this gene that result in enzymatic deficiency lead to the autosomal recessive disease mucopolysaccharidosis type I (MPS I). |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Bio-activity : | Not mentioned |
| Molecular Mass : | 70 kDa |
| AA Sequence : | MRPLRPRAALLALLASLLAAPPVAPAEAPHLVHVDAARALWPLRRFWRSTGFCPPLPHSQADQYVLSWDQ QLNLAYVGAVPHRGIKQVRTHWLLELVTTRGSTGRGLSYNFTHLDGYLDLLRENQLLPGFELMGSASGHF TDFEDKQQVFEWKDLVSSLARRYIGRYGLAHVSKWNFETWNEPDHHDFDNVSMTMQGFLNYYDACSEGLR AASPALRLGGPGDSFHTPPRSPLSWGLLRHCHDGTNFFTGEAGVRLDYISLHRKGARSSISILEQEKVVA QQIRQLFPKFADTPIYNDEADPLVGWSLPQPWRADVTYAAMVVKVIAQHQNLLLANTTSAFPYALLSNDN AFLSYHPHPFAQRTLTARFQVNNTRPPHVQLLRKPVLTAMGLLALLDEEQLWAEVSQAGTVLDSNHTVGV LASAHRPQGPADAWRAAVLIYASDDTRAHPNRSVAVTLRLRGVPPGPGLVYVTRYLDNGLCSPDGEWRRL GRPVFPTAEQFRRMRAAEDPVAAAPRPLPAGGRLTLRPALRLPSLLLVHVCARPEKPPGQVTRLRALPLT QGQLVLVWSDEHVGSKCLWTYEIQFSQDGKAYTPVSRKPSTFNLFVFSPDTGAVSGSYRVRALDYWARPG PFSDPVPYLEVPVPRGPPSPGNPSGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Families : | Druggable Genome |
| Protein Pathways : | Glycosaminoglycan degradation, Lysosome, Metabolic pathways |
| Full Length : | Full L. |
| Gene Name | IDUA alpha-L-iduronidase [ Homo sapiens (human) ] |
| Official Symbol | IDUA |
| Synonyms | IDA; MPS1; MPSI |
| Gene ID | 3425 |
| mRNA Refseq | NM_000203.5 |
| Protein Refseq | NP_000194.2 |
| MIM | 252800 |
| UniProt ID | P35475 |
| ◆ Recombinant Proteins | ||
| IDUA-1140H | Recombinant Human IDUA Protein, His (Fc)-Avi-tagged | +Inquiry |
| IDUA-569H | Recombinant Human IDUA Protein (28-653 aa), His-tagged | +Inquiry |
| Idua-220M | Active Recombinant Mouse Idua protein, His-tagged | +Inquiry |
| IDUA-3134H | Recombinant Human IDUA Protein, His (Fc)-Avi-tagged | +Inquiry |
| IDUA-1579H | Recombinant Human IDUA protein, His & T7-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IDUA Products
Required fields are marked with *
My Review for All IDUA Products
Required fields are marked with *
