Recombinant Full Length Human IFFO1 Protein, GST-tagged

Cat.No. : IFFO1-3694HF
Product Overview : Human HOM-TES-103 full-length ORF ( NP_542769.2, 1 a.a. - 200 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 200 amino acids
Description : This gene is a member of the intermediate filament family. Intermediate filaments are proteins which are primordial components of the cytoskeleton and nuclear envelope. The proteins encoded by the members of this gene family are evolutionarily and structurally related but have limited sequence homology, with the exception of the central rod domain. Alternative splicing has been observed for this gene and three transcript variants encoding different isoforms have been identified. Other alternatively spliced transcripts may exist, but their biological validity has not been confirmed. [provided by RefSeq
Molecular Mass : 49.3 kDa
AA Sequence : MGGRKRERKAAVEEDTSLSESEGPRQPDGDEEESTALSINEEMQRMLNQLREYDFEDDCDSLTWEETEETLLLWEDFSGYAMAAAEAQGEQQEDSLEKVIKDTESLFKTREKEYQETIDQIELELATAKNDMNRHLHEYMEMCSMKRGLDVQMETCRRLITQSGDRKSPAFTAVPLSDPPPPPSEAEDSDRDVSSDSSMR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name IFFO1 intermediate filament family orphan 1 [ Homo sapiens ]
Official Symbol IFFO1
Synonyms IFFO1; intermediate filament family orphan 1; IFFO, intermediate filament family orphan; HOM TES 103; intermediate filament-like MGC:2625; IFFO; HOM-TES-103; FLJ20703; MGC117359; DKFZp586I2223;
Gene ID 25900
mRNA Refseq NM_001039670
Protein Refseq NP_001034759
MIM 610495
UniProt ID Q0D2I5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IFFO1 Products

Required fields are marked with *

My Review for All IFFO1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon