Recombinant Full Length Human IFFO1 Protein, GST-tagged
Cat.No. : | IFFO1-3694HF |
Product Overview : | Human HOM-TES-103 full-length ORF ( NP_542769.2, 1 a.a. - 200 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 200 amino acids |
Description : | This gene is a member of the intermediate filament family. Intermediate filaments are proteins which are primordial components of the cytoskeleton and nuclear envelope. The proteins encoded by the members of this gene family are evolutionarily and structurally related but have limited sequence homology, with the exception of the central rod domain. Alternative splicing has been observed for this gene and three transcript variants encoding different isoforms have been identified. Other alternatively spliced transcripts may exist, but their biological validity has not been confirmed. [provided by RefSeq |
Molecular Mass : | 49.3 kDa |
AA Sequence : | MGGRKRERKAAVEEDTSLSESEGPRQPDGDEEESTALSINEEMQRMLNQLREYDFEDDCDSLTWEETEETLLLWEDFSGYAMAAAEAQGEQQEDSLEKVIKDTESLFKTREKEYQETIDQIELELATAKNDMNRHLHEYMEMCSMKRGLDVQMETCRRLITQSGDRKSPAFTAVPLSDPPPPPSEAEDSDRDVSSDSSMR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | IFFO1 intermediate filament family orphan 1 [ Homo sapiens ] |
Official Symbol | IFFO1 |
Synonyms | IFFO1; intermediate filament family orphan 1; IFFO, intermediate filament family orphan; HOM TES 103; intermediate filament-like MGC:2625; IFFO; HOM-TES-103; FLJ20703; MGC117359; DKFZp586I2223; |
Gene ID | 25900 |
mRNA Refseq | NM_001039670 |
Protein Refseq | NP_001034759 |
MIM | 610495 |
UniProt ID | Q0D2I5 |
◆ Recombinant Proteins | ||
IFFO1-8001M | Recombinant Mouse IFFO1 Protein | +Inquiry |
IFFO1-4423M | Recombinant Mouse IFFO1 Protein, His (Fc)-Avi-tagged | +Inquiry |
IFFO1-4927H | Recombinant Human IFFO1 Protein, GST-tagged | +Inquiry |
IFFO1-3694HF | Recombinant Full Length Human IFFO1 Protein, GST-tagged | +Inquiry |
IFFO1-14059H | Recombinant Human IFFO1, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFFO1-808HCL | Recombinant Human IFFO1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFFO1 Products
Required fields are marked with *
My Review for All IFFO1 Products
Required fields are marked with *
0
Inquiry Basket