Recombinant Full Length Human IFI35 Protein
Cat.No. : | IFI35-249HF |
Product Overview : | Recombinant full length Human IFI35 with N-terminal proprietary tag. Predicted MW 57.75kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 288 amino acids |
Description : | Enables identical protein binding activity. Involved in several processes, including macrophage activation involved in immune response; positive regulation of defense response; and regulation of signal transduction. Located in several cellular components, including cytosol; extracellular space; and nucleus. |
Form : | Liquid |
Molecular Mass : | 57.750kDa inclusive of tags |
AA Sequence : | MSAPLDAALHALQEEQARLKMRLWDLQQLRKELGDSPKDK VPFSVPKIPLVFRGHTQQDPEVPKSLVSNLRIHCPLLAGS ALITFDDPKVAEQVLQQKEHTINMEECRLRVQVQPLELPM VTTIQVMVSSQLSGRRVLVTGFPASLRLSEEELLDKLEIF FGKTRNGGGDVDVRELLPGSVMLGFARDGVAQRLCQIGQF TVPLGGQQVPLRVSPYVNGEIQKAEIRSQPVPRSVLVLNI PDILDGPELHDVLEIHFQKPTRGGGEVEALTVVPQGQQGL AVFTSESG |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | IFI35 interferon-induced protein 35 [ Homo sapiens ] |
Official Symbol | IFI35 |
Synonyms | IFI35; interferon-induced protein 35; interferon-induced 35 kDa protein; IFP35 |
Gene ID | 3430 |
mRNA Refseq | NM_005533 |
Protein Refseq | NP_005524 |
MIM | 600735 |
UniProt ID | P80217 |
◆ Recombinant Proteins | ||
IFI35-1142H | Recombinant Human IFI35 Protein, His (Fc)-Avi-tagged | +Inquiry |
IFI35-3371H | Recombinant Human IFI35 Protein (Ser2-Gly286), N-His tagged | +Inquiry |
IFI35-5254H | Recombinant Human IFI35 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
IFI35-1860H | Recombinant Human IFI35 protein, His & T7-tagged | +Inquiry |
Ifi35-3477M | Recombinant Mouse Ifi35 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFI35-5293HCL | Recombinant Human IFI35 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFI35 Products
Required fields are marked with *
My Review for All IFI35 Products
Required fields are marked with *
0
Inquiry Basket