Recombinant Full Length Human IFI6 Protein, GST-tagged
Cat.No. : | IFI6-5102HF |
Product Overview : | Human G1P3 full-length ORF ( AAH11601, 1 a.a. - 130 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 130 amino acids |
Description : | This gene was first identified as one of the many genes induced by interferon. The encoded protein may play a critical role in the regulation of apoptosis. A minisatellite that consists of 26 repeats of a 12 nucleotide repeating element resembling the mammalian splice donor consensus sequence begins near the end of the second exon. Alternatively spliced transcript variants that encode different isoforms by using the two downstream repeat units as splice donor sites have been described. [provided by RefSeq |
Molecular Mass : | 40.04 kDa |
AA Sequence : | MRQKAVSLFLCYLLLFTCSGVEAGKKKCSESSDSGSGFWKALTFMAVGGGLAVAGLPALGFTGAGIAANSVAASLMSWSAILNGGGVPAGGLVATLQSLGAGGSCVVIGNIGALMGYATHKYLDSEEDEE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | IFI6 interferon, alpha-inducible protein 6 [ Homo sapiens ] |
Official Symbol | IFI6 |
Synonyms | IFI6; interferon, alpha-inducible protein 6; G1P3, interferon, alpha inducible protein (clone IFI 6 16); interferon alpha-inducible protein 6; 6 16; FAM14C; IFI 6 16; IFI616; interferon-induced protein 6-16; interferon, alpha-inducible protein clone IFI-6-16; 6-16; G1P3; IFI-6-16; |
Gene ID | 2537 |
mRNA Refseq | NM_002038 |
Protein Refseq | NP_002029 |
MIM | 147572 |
UniProt ID | P09912 |
◆ Recombinant Proteins | ||
IFI6-2021R | Recombinant Rhesus Macaque IFI6 Protein, His (Fc)-Avi-tagged | +Inquiry |
IFI6-4608H | Recombinant Human IFI6 Protein, GST-tagged | +Inquiry |
IFI6-5102HF | Recombinant Full Length Human IFI6 Protein, GST-tagged | +Inquiry |
IFI6-2200R | Recombinant Rhesus monkey IFI6 Protein, His-tagged | +Inquiry |
RFL10362PF | Recombinant Full Length Pan Troglodytes Interferon Alpha-Inducible Protein 6(Ifi6) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFI6-5291HCL | Recombinant Human IFI6 293 Cell Lysate | +Inquiry |
IFI6-5290HCL | Recombinant Human IFI6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFI6 Products
Required fields are marked with *
My Review for All IFI6 Products
Required fields are marked with *