Recombinant Full Length Human IFNA2 Protein, C-Flag-tagged
Cat.No. : | IFNA2-1913HFL |
Product Overview : | Recombinant Full Length Human IFNA2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene is a member of the alpha interferon gene cluster on chromosome 9. The encoded cytokine is a member of the type I interferon family that is produced in response to viral infection as a key part of the innate immune response with potent antiviral, antiproliferative and immunomodulatory properties. This cytokine, like other type I interferons, binds a plasma membrane receptor made of IFNAR1 and IFNAR2 that is ubiquitously expressed, and thus is able to act on virtually all body cells. The encoded protein is effective in reducing the symptoms and duration of the common cold and in treating many types of cancer, including some hematological malignancies and solid tumors. A deficiency of type I interferon in the blood is thought to be a hallmark of severe COVID-19 and may provide a rationale for a combined therapeutic approach. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 21.4 kDa |
AA Sequence : | MALTFALLVALLVLSCKSSCSVGCDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQF QKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSIL AVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein |
Protein Pathways : | Antigen processing and presentation, Autoimmune thyroid disease, Cytokine-cytokine receptor interaction, Cytosolic DNA-sensing pathway, Jak-STAT signaling pathway, Natural killer cell mediated cytotoxicity, Regulation of autophagy, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway |
Full Length : | Full L. |
Gene Name | IFNA2 interferon alpha 2 [ Homo sapiens (human) ] |
Official Symbol | IFNA2 |
Synonyms | IFNA; IFNA2B; leIF A; IFN-alphaA; IFN-alpha-2 |
Gene ID | 3440 |
mRNA Refseq | NM_000605.4 |
Protein Refseq | NP_000596.2 |
MIM | 147562 |
UniProt ID | P01563 |
◆ Recombinant Proteins | ||
IFNA2-2270H | Recombinant Human IFNA2 Protein, His-tagged | +Inquiry |
IFNA2-1554H | Recombinant human IFNA2, Active, His-tagged | +Inquiry |
IFNA2-601P | Active Recombinant Porcine IFNA2 | +Inquiry |
IFNA2-02H | Recombinant Human Pegylated Interferon Alpha-2a | +Inquiry |
IFNA2-114H | Active Recombinant Human IFN-alpha 2b Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNA2-954CCL | Recombinant Cynomolgus IFNA2 cell lysate | +Inquiry |
IFNA2-1634MCL | Recombinant Mouse IFNA2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IFNA2 Products
Required fields are marked with *
My Review for All IFNA2 Products
Required fields are marked with *
0
Inquiry Basket