Recombinant Full Length Human IGF2BP2 Protein, C-Flag-tagged
Cat.No. : | IGF2BP2-92HFL |
Product Overview : | Recombinant Full Length Human IGF2BP2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a protein that binds the 5' UTR of insulin-like growth factor 2 (IGF2) mRNA and regulates its translation. It plays an important role in metabolism and variation in this gene is associated with susceptibility to diabetes. Alternative splicing and promoter usage results in multiple transcript variants. Related pseudogenes are found on several chromosomes. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 65.9 kDa |
AA Sequence : | MNKLYIGNLSPAVTADDLRQLFGDRKLPLAGQVLLKSGYAFVDYPDQNWAIRAIETLSGKVELHGKIMEV DYSVSKKLRSRKIQIRNIPPHLQWEVLDGLLAQYGTVENVEQVNTDTETAVVNVTYATREEAKIAMEKLS GHQFENYSFKISYIPDEEVSSPSPPQRAQRGDHSSREQGHAPGGTSQARQIDFPLRILVPTQFVGAIIGK EGLTIKNITKQTQSRVDIHRKENSGAAEKPVTIHATPEGTSEACRMILEIMQKEADETKLAEEIPLKILA HNGLVGRLIGKEGRNLKKIEHETGTKITISSLQDLSIYNPERTITVKGTVEACASAEIEIMKKLREAFEN DMLAVNQQANLIPGLNLSALGIFSTGLSVLSPPAGPRGAPPAAPYHPFTTHSGYFSSLYPHHQFGPFPHH HSYPEQEIVNLFIPTQAVGAIIGKKGAHIKQLARFAGASIKIAPAEGPDVSERMVIITGPPEAQFKAQGR IFGKLKEENFFNPKEEVKLEAHIRVPSSTAGRVIGKGGKTVNELQNLTSAEVIVPRDQTPDENEEVIVRI IGHFFASQTAQRKIREIVQQVKQQEQKYPQGVASQRSKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | IGF2BP2 insulin like growth factor 2 mRNA binding protein 2 [ Homo sapiens (human) ] |
Official Symbol | IGF2BP2 |
Synonyms | IMP2; IMP-2; VICKZ2 |
Gene ID | 10644 |
mRNA Refseq | NM_006548.6 |
Protein Refseq | NP_006539.3 |
MIM | 608289 |
UniProt ID | Q9Y6M1 |
◆ Recombinant Proteins | ||
IGF2BP2-1390H | Recombinant Human IGF2BP2 Protein, His/T7-tagged | +Inquiry |
IGF2BP2-5150H | Recombinant Human IGF2BP2 Protein, GST-tagged | +Inquiry |
IGF2BP2-4463M | Recombinant Mouse IGF2BP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
IGF2BP2-3874H | Recombinant Human IGF2BP2 protein, His&GST-tagged | +Inquiry |
IGF2BP2-92HFL | Recombinant Full Length Human IGF2BP2 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IGF2BP2-639HCL | Recombinant Human IGF2BP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IGF2BP2 Products
Required fields are marked with *
My Review for All IGF2BP2 Products
Required fields are marked with *
0
Inquiry Basket