Recombinant Full Length Human IGFALS Protein, C-Flag-tagged
Cat.No. : | IGFALS-703HFL |
Product Overview : | Recombinant Full Length Human IGFALS Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a serum protein that binds insulin-like growth factors, increasing their half-life and their vascular localization. Production of the encoded protein, which contains twenty leucine-rich repeats, is stimulated by growth hormone. Defects in this gene are a cause of acid-labile subunit deficiency, which maifests itself in a delayed and slow puberty. Three transcript variants encoding two different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 63.2 kDa |
AA Sequence : | MALRKGGLALALLLLSWVALGPRSLEGADPGTPGEAEGPACPAACVCSYDDDADELSVFCSSRNLTRLPD GVPGGTQALWLDGNNLSSVPPAAFQNLSSLGFLNLQGGQLGSLEPQALLGLENLCHLHLERNQLRSLALG TFAHTPALASLGLSNNRLSRLEDGLFEGLGSLWDLNLGWNSLAVLPDAAFRGLGSLRELVLAGNRLAYLQ PALFSGLAELRELDLSRNALRAIKANVFVQLPRLQKLYLDRNLIAAVAPGAFLGLKALRWLDLSHNRVAG LLEDTFPGLLGLRVLRLSHNAIASLRPRTFKDLHFLEELQLGHNRIRQLAERSFEGLGQLEVLTLDHNQL QEVKAGAFLGLTNMAVMNLSGNCLRNLPEQVFRGLGKLHSLHLEGSCLGRIRPHTFTGLSGLRRLFLKDN GLVGIEEQSLWGLAELLELDLTSNQLTHLPHRLFQGLGKLEYLLLSRNRLAELPADALGPLQRAFWLDVS HNRLEALPNSLLAPLGRLRYLSLRNNSLRTFTPQPPGLERLWLEGNPWDCGCPLKALRDFALQNPSAVPR FVQAICEGDDCQPPAYTYNNITCASPPEVVGLDLRDLSEAHFAPCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein |
Full Length : | Full L. |
Gene Name | IGFALS insulin like growth factor binding protein acid labile subunit [ Homo sapiens (human) ] |
Official Symbol | IGFALS |
Synonyms | ALS; ACLSD |
Gene ID | 3483 |
mRNA Refseq | NM_004970.3 |
Protein Refseq | NP_004961.1 |
MIM | 601489 |
UniProt ID | P35858 |
◆ Recombinant Proteins | ||
IGFALS-703HFL | Recombinant Full Length Human IGFALS Protein, C-Flag-tagged | +Inquiry |
IGFALS-6854H | Recombinant Human IGFALS protein, His-tagged | +Inquiry |
IGFALS-3006R | Recombinant Rat IGFALS Protein | +Inquiry |
IGFALS-2662R | Recombinant Rat IGFALS Protein, His (Fc)-Avi-tagged | +Inquiry |
IGFALS-14104H | Recombinant Human IGFALS, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IGFALS-5264HCL | Recombinant Human IGFALS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IGFALS Products
Required fields are marked with *
My Review for All IGFALS Products
Required fields are marked with *
0
Inquiry Basket