Recombinant Full Length Human IGFBP4 Protein, C-Flag-tagged

Cat.No. : IGFBP4-1416HFL
Product Overview : Recombinant Full Length Human IGFBP4 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma in both glycosylated and non-glycosylated forms. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 25.9 kDa
AA Sequence : MLPLCLVAALLLAAGPGPSLGDEAIHCPPCSEEKLARCRPPVGCEELVREPGCGCCATCALGLGMPCGVY TPRCGSGLRCYPPRGVEKPLHTLMHGQGVCMELAEIEAIQESLQPSDKDEGDHPNNSFSPCSAHDRRCLQ KHFAKIRDRSTSGGKMKVNGAPREDARPVPQGSCQSELHRALERLAASQSRTHEDLYIIPIPNCDRNGNF
HPKQCHPALDGQRGKCWCVDRKTGVKLPGGLEPKGELDCHQLADSFRETRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Secreted Protein
Full Length : Full L.
Gene Name IGFBP4 insulin like growth factor binding protein 4 [ Homo sapiens (human) ]
Official Symbol IGFBP4
Synonyms BP-4; IBP4; IGFBP-4; HT29-IGFBP
Gene ID 3487
mRNA Refseq NM_001552.3
Protein Refseq NP_001543.2
MIM 146733
UniProt ID P22692

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IGFBP4 Products

Required fields are marked with *

My Review for All IGFBP4 Products

Required fields are marked with *

0
cart-icon
0
compare icon