Recombinant Full Length Human IGIP Protein, GST-tagged

Cat.No. : IGIP-5887HF
Product Overview : Human LOC492311 full-length ORF (AAH17422.2, 1 a.a. - 53 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 53 amino acids
Description : IGIP (IgA Inducing Protein) is a Protein Coding gene.
Molecular Mass : 32.23 kDa
AA Sequence : MCSYYHMKKRSVSGCNITIFAVMFSHLSAGKSPCGNQANVLCISRLEFVQYQS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name IGIP IgA inducing protein [ Homo sapiens (human) ]
Official Symbol IGIP
Synonyms IGIP; IgA inducing protein; C5orf53; IgA-inducing protein homolog; IgA-inducing protein homolog (Bos taurus)
Gene ID 492311
mRNA Refseq NM_001007189
Protein Refseq NP_001007190
UniProt ID A6NJ69

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IGIP Products

Required fields are marked with *

My Review for All IGIP Products

Required fields are marked with *

0
cart-icon