Recombinant Full Length Human IGIP Protein, GST-tagged
Cat.No. : | IGIP-5887HF |
Product Overview : | Human LOC492311 full-length ORF (AAH17422.2, 1 a.a. - 53 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 53 amino acids |
Description : | IGIP (IgA Inducing Protein) is a Protein Coding gene. |
Molecular Mass : | 32.23 kDa |
AA Sequence : | MCSYYHMKKRSVSGCNITIFAVMFSHLSAGKSPCGNQANVLCISRLEFVQYQS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | IGIP IgA inducing protein [ Homo sapiens (human) ] |
Official Symbol | IGIP |
Synonyms | IGIP; IgA inducing protein; C5orf53; IgA-inducing protein homolog; IgA-inducing protein homolog (Bos taurus) |
Gene ID | 492311 |
mRNA Refseq | NM_001007189 |
Protein Refseq | NP_001007190 |
UniProt ID | A6NJ69 |
◆ Recombinant Proteins | ||
IGIP-5887HF | Recombinant Full Length Human IGIP Protein, GST-tagged | +Inquiry |
IGIP-2301H | Recombinant Human IGIP protein, His-TF-tagged | +Inquiry |
IGIP-4284H | Recombinant Human IGIP protein, His-KSI-tagged | +Inquiry |
IGIP-2041R | Recombinant Rhesus Macaque IGIP Protein, His (Fc)-Avi-tagged | +Inquiry |
IGIP-5892H | Recombinant Human IGIP protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IGIP-8007HCL | Recombinant Human C5orf53 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IGIP Products
Required fields are marked with *
My Review for All IGIP Products
Required fields are marked with *
0
Inquiry Basket