Recombinant Full Length Human IL27RA Protein, C-Flag-tagged
Cat.No. : | IL27RA-876HFL |
Product Overview : | Recombinant Full Length Human IL27RA Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | In mice, CD4+ helper T-cells differentiate into type 1 (Th1) cells, which are critical for cell-mediated immunity, predominantly under the influence of IL12. Also, IL4 influences their differentiation into type 2 (Th2) cells, which are critical for most antibody responses. Mice deficient in these cytokines, their receptors, or associated transcription factors have impaired, but are not absent of, Th1 or Th2 immune responses. This gene encodes a protein which is similar to the mouse T-cell cytokine receptor Tccr at the amino acid level, and is predicted to be a glycosylated transmembrane protein. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 69.3 kDa |
AA Sequence : | MRGGRGAPFWLWPLPKLALLPLLWVLFQRTRPQGSAGPLQCYGVGPLGDLNCSWEPLGDLGAPSELHLQ SQKYRSNKTQTVAVAAGRSWVAIPREQLTMSDKLLVWGTKAGQPLWPPVFVNLETQMKPNAPRLGPDVD FSEDDPLEATVHWAPPTWPSHKVLICQFHYRRCQEAAWTLLEPELKTIPLTPVEIQDLELATGYKVYGR CRMEKEEDLWGEWSPILSFQTPPSAPKDVWVSGNLCGTPGGEEPLLLWKAPGPCVQVSYKVWFWVGGRE LSPEGITCCCSLIPSGAEWARVSAVNATSWEPLTNLSLVCLDSASAPRSVAVSSIAGSTELLVTWQPGP GEPLEHVVDWARDGDPLEKLNWVRLPPGNLSALLPGNFTVGVPYRITVTAVSASGLASASSVWGFREEL APLVGPTLWRLQDAPPGTPAIAWGEVPRHQLRGHLTHYTLCAQSGTSPSVCMNVSGNTQSVTLPDLPWG PCELWVTASTIAGQGPPGPILRLHLPDNTLRWKVLPGILFLWGLFLLGCGLSLATSGRCYHLRHKVLPR WVWEKVPDPANSSSGQPHMEQVPEAQPLGDLPILEVEEMEPPPVMESSQPAQATAPLDSGYEKHFLPTP EELGLLGPPRPQVLASGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Full Length : | Full L. |
Gene Name | IL27RA interleukin 27 receptor subunit alpha [ Homo sapiens (human) ] |
Official Symbol | IL27RA |
Synonyms | CRL1; TCCR; WSX1; IL27R; IL-27RA; zcytor1 |
Gene ID | 9466 |
mRNA Refseq | NM_004843.4 |
Protein Refseq | NP_004834.1 |
MIM | 605350 |
UniProt ID | Q6UWB1 |
◆ Recombinant Proteins | ||
IZUMO4-06H | Recombinant Human IZUMO4, Fc-tagged | +Inquiry |
CRYBB2-1272R | Recombinant Rat CRYBB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Henmt1-3383M | Recombinant Mouse Henmt1 Protein, Myc/DDK-tagged | +Inquiry |
SLAMF6-016H | Recombinant Human SLAMF6 Protein, C-His-tagged | +Inquiry |
NDUFS1-3606H | Recombinant Human NDUFS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
RWX-308S | Native Snake RVV-X ACTIVATOR | +Inquiry |
IBVF0406-225I | Native Influenza (B/Florida 04/06) IBVF0406 protein | +Inquiry |
HBsAg-01 | Native Hepatitis B Surface Ag protein | +Inquiry |
Lipoprotein-246 | Native Human Oxidized LDL (Ox-LDL) | +Inquiry |
H3N2-03I | Active Native IAV H3N2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM128B-6432HCL | Recombinant Human FAM128B 293 Cell Lysate | +Inquiry |
SND1-1630HCL | Recombinant Human SND1 293 Cell Lysate | +Inquiry |
IL3RA-2433HCL | Recombinant Human IL3RA cell lysate | +Inquiry |
CFAP44-342HCL | Recombinant Human WDR52 293 Cell Lysate | +Inquiry |
C4orf27-118HCL | Recombinant Human C4orf27 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL27RA Products
Required fields are marked with *
My Review for All IL27RA Products
Required fields are marked with *
0
Inquiry Basket