Recombinant Full Length Human IL37 Protein, C-Flag-tagged
Cat.No. : | IL37-949HFL |
Product Overview : | Recombinant Full Length Human IL37 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine can bind to, and may be a ligand for interleukin 18 receptor (IL18R1/IL-1Rrp). This cytokine also binds to interleukin 18 binding protein (IL18BP), an inhibitory binding protein of interleukin 18 (IL18), and subsequently forms a complex with IL18 receptor beta subunit, and through which it inhibits the activity of IL18. This gene along with eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. Five alternatively spliced transcript variants encoding distinct isoforms have been reported. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 23.9 kDa |
AA Sequence : | MSFVGENSGVKMGSEDWEKDEPQCCLEDPAVSPLEPGPSLPAMNFVHTSPKVKNLNPKKFSIHDQDHKVL VLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKL MKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAE MSPSEVSDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein |
Full Length : | Full L. |
Gene Name | IL37 interleukin 37 [ Homo sapiens (human) ] |
Official Symbol | IL37 |
Synonyms | FIL1; FIL1Z; IL-1H; IL-23; IL-37; IL1F7; IL1H4; IL-1F7; IL-1H4; IL1RP1; IL-1RP1; FIL1(ZETA) |
Gene ID | 27178 |
mRNA Refseq | NM_014439.4 |
Protein Refseq | NP_055254.2 |
MIM | 605510 |
UniProt ID | Q9NZH6 |
◆ Recombinant Proteins | ||
IL37-7843H | Recombinant Human IL37 | +Inquiry |
IL37-0188H | Recombinant Human IL37 protein, His-tagged | +Inquiry |
IL37-753H | Recombinant Human IL37 protein | +Inquiry |
IL37-3214H | Recombinant Human IL37 protein, His-tagged | +Inquiry |
IL37-151H | Recombinant Human IL37 Protein, DYKDDDDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL37-5237HCL | Recombinant Human IL1F7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL37 Products
Required fields are marked with *
My Review for All IL37 Products
Required fields are marked with *
0
Inquiry Basket