Recombinant Full Length Human IL6R Protein
| Cat.No. : | IL6R-5689HF |
| Product Overview : | Human IL6R full-length ORF (NP_000556.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 178 amino acids |
| Description : | Interleukin 6 (IL6) is a potent pleiotropic cytokine that regulates cell growth and differentiation and plays an important role in immune response. The protein encoded by this gene is a subunit of the receptor complex for IL6. The IL6 receptor is a protein complex consisting of this protein and interleukin 6 signal transducer (IL6ST/GP130/IL6-beta), a receptor subunit also shared by many other cytokines. Dysregulated production of IL6 and this receptor are implicated in the pathogenesis of many diseases, such as multiple myeloma, autoimmune diseases and prostate cancer. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq |
| Form : | Liquid |
| Molecular Mass : | 51.5 kDa |
| AA Sequence : | MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR |
| Applications : | Antibody Production Functional Study Compound Screening |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Gene Name | IL6R interleukin 6 receptor [ Homo sapiens ] |
| Official Symbol | IL6R |
| Synonyms | IL6R; interleukin 6 receptor; interleukin-6 receptor subunit alpha; CD126; IL-6R 1; CD126 antigen; membrane glycoprotein 80; IL-6 receptor subunit alpha; gp80; IL6RA; IL-6RA; IL-6R-1; MGC104991; |
| Gene ID | 3570 |
| mRNA Refseq | NM_000565 |
| Protein Refseq | NP_000556 |
| MIM | 147880 |
| UniProt ID | P08887 |
| ◆ Recombinant Proteins | ||
| IL6R-1064C | Active Recombinant Canine IL6R protein, His-tagged | +Inquiry |
| IL6R-213H | Recombinant Human IL6R Protein (ECD), His-tagged(C-ter) | +Inquiry |
| IL6R-1560R | Recombinant Rhesus Monkey IL6R Protein, hIgG1-tagged | +Inquiry |
| IL6R-3837H | Recombinant Human IL6R Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| IL6R-200H | Active Recombinant Human IL6R, MIgG2a Fc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL6R-2903HCL | Recombinant Human IL6R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL6R Products
Required fields are marked with *
My Review for All IL6R Products
Required fields are marked with *
