Recombinant Full Length Human IL6R Protein, GST-tagged
Cat.No. : | IL6R-5692HF |
Product Overview : | Human IL6R full-length ORF ( NP_000556.1, 1 a.a. - 468 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 468 amino acids |
Description : | Interleukin 6 (IL6) is a potent pleiotropic cytokine that regulates cell growth and differentiation and plays an important role in immune response. The protein encoded by this gene is a subunit of the receptor complex for IL6. The IL6 receptor is a protein complex consisting of this protein and interleukin 6 signal transducer (IL6ST/GP130/IL6-beta), a receptor subunit also shared by many other cytokines. Dysregulated production of IL6 and this receptor are implicated in the pathogenesis of many diseases, such as multiple myeloma, autoimmune diseases and prostate cancer. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq |
Molecular Mass : | 77.9 kDa |
AA Sequence : | MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | IL6R interleukin 6 receptor [ Homo sapiens ] |
Official Symbol | IL6R |
Synonyms | IL6R; interleukin 6 receptor; interleukin-6 receptor subunit alpha; CD126; IL-6R 1; CD126 antigen; membrane glycoprotein 80; IL-6 receptor subunit alpha; gp80; IL6RA; IL-6RA; IL-6R-1; MGC104991; |
Gene ID | 3570 |
mRNA Refseq | NM_000565 |
Protein Refseq | NP_000556 |
MIM | 147880 |
UniProt ID | P08887 |
◆ Recombinant Proteins | ||
IL6R-1418H | Recombinant Human IL6R Protein (Met1-Pro365), N-His tagged | +Inquiry |
IL6R-5689HF | Recombinant Full Length Human IL6R Protein | +Inquiry |
Il6r-1145R | Recombinant Rat Il6r protein(Met1-Pro364), His-tagged | +Inquiry |
IL6R-5175H | Recombinant Human IL6R Protein | +Inquiry |
IL6R-2768H | Recombinant Human IL6R Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL6R-2903HCL | Recombinant Human IL6R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL6R Products
Required fields are marked with *
My Review for All IL6R Products
Required fields are marked with *
0
Inquiry Basket