Recombinant Full Length Human IL7R Protein, C-Flag-tagged
Cat.No. : | IL7R-1471HFL |
Product Overview : | Recombinant Full Length Human IL7R Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a receptor for interleukin 7 (IL7). The function of this receptor requires the interleukin 2 receptor, gamma chain (IL2RG), which is a common gamma chain shared by the receptors of various cytokines, including interleukins 2, 4, 7, 9, and 15. This protein has been shown to play a critical role in V(D)J recombination during lymphocyte development. Defects in this gene may be associated with severe combined immunodeficiency (SCID). Alternatively spliced transcript variants have been found. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 49.4 kDa |
AA Sequence : | MTILGTTFGMVFSLLQVVSGESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFEDPDVNITNLE FEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKKIDLTTIVKPEAPFDLSVIYR EGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTHVNLSSTKLTLLQRKLQPAAMYEIKVRSIPD HYFKGFWSEWSPSYYFRTPEINNSSGEMDPILLTISILSFFSVALLVILACVLWKKRIKPIVWPSLPDHK KTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQARDEVEGFLQDTFPQQLEESEKQRLGGDVQSPNCP SEDVVITPESFGRDSSLTCLAGNVSACDAPILSPSRSLDCRESGKNGPHVYQDLLLSLGTTNSTLPPPFS LQSGILTLNPVAQGQPILTSLGSNQEEAYVTMSSFYQNQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, ES Cell Differentiation/IPS, Transmembrane |
Protein Pathways : | Cytokine-cytokine receptor interaction, Hematopoietic cell lineage, Jak-STAT signaling pathway, Primary immunodeficiency |
Full Length : | Full L. |
Gene Name | IL7R interleukin 7 receptor [ Homo sapiens (human) ] |
Official Symbol | IL7R |
Synonyms | ILRA; CD127; IL7RA; CDW127; IMD104; lnc-IL7R; IL-7R-alpha |
Gene ID | 3575 |
mRNA Refseq | NM_002185.5 |
Protein Refseq | NP_002176.2 |
MIM | 146661 |
UniProt ID | P16871 |
◆ Recombinant Proteins | ||
IL7R-2179H | Recombinant Human IL7R Protein, MYC/DDK-tagged | +Inquiry |
IL7R-1951H | Recombinant Human IL7R protein, His & GST-tagged | +Inquiry |
IL7R-5169H | Recombinant Human IL7R Protein | +Inquiry |
Il7r-1953R | Recombinant Rat Il7r protein, His & T7-tagged | +Inquiry |
IL7R-1180H | Recombinant Human IL7R Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL7R-2473MCL | Recombinant Mouse IL7R cell lysate | +Inquiry |
IL7R-959RCL | Recombinant Rat IL7R cell lysate | +Inquiry |
IL7R-2595HCL | Recombinant Human IL7R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL7R Products
Required fields are marked with *
My Review for All IL7R Products
Required fields are marked with *
0
Inquiry Basket