Recombinant Full Length Human ILF3 Protein, GST-tagged
| Cat.No. : | ILF3-5794HF |
| Product Overview : | Human ILF3 full-length ORF ( AAH03086, 1 a.a. - 158 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 158 amino acids |
| Description : | This gene encodes a double-stranded RNA (dsRNA) binding protein that complexes with other proteins, dsRNAs, small noncoding RNAs, and mRNAs to regulate gene expression and stabilize mRNAs. This protein was first discovered to be a subunit of the nuclear factor of activated T-cells (NFAT); a transcription factor required for T-cell expression of interleukin 2. NFAT is a heterodimer of 45 kDa and 90 kDa proteins, the larger of which is the product of this gene. These proteins have been shown to affect the redistribution of nuclear mRNA to the cytoplasm. Knockdown of NF45 or NF90 protein retards cell growth; possibly by inhibition of mRNA stabilization. In contrast, an isoform (NF110) of this gene that is predominantly restricted to the nucleus has only minor effects on cell growth when its levels are reduced. Alternative splicing results in multiple transcript variants encoding distinct isoforms |
| Molecular Mass : | 43.12 kDa |
| AA Sequence : | MCSCPISSPGHIKGLGQEETPVRSADLVFKERMPACNTHGEGHFLAPPAKYLQTLGRRLHSQHRTSLNSFRISDHHHVQVSECRPTTRDGFHPPALLQIHAAQQARAWREQLLSTAPLEPSPRSRSSPVLMMPSCCWPETVSQLQQDDTGFRNMWLSP |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ILF3 interleukin enhancer binding factor 3, 90kDa [ Homo sapiens ] |
| Official Symbol | ILF3 |
| Synonyms | ILF3; interleukin enhancer binding factor 3, 90kDa; interleukin enhancer binding factor 3, 90kD; interleukin enhancer-binding factor 3; DRBP76; M phase phosphoprotein 4; MPHOSPH4; MPP4; NF90; NFAR 1; M-phase phosphoprotein 4; translational control protein 80; dsRNA binding protein NFAR-2/MPP4; nuclear factor associated with dsRNA; double-stranded RNA-binding protein, 76 kD; nuclear factor of activated T-cells 90 kDa; nuclear factor of activated T-cells, 90 kD; CBTF; DRBF; MMP4; NFAR; NF110; NF90a; NF90b; NFAR2; TCP80; NF110b; NFAR-1; TCP110; NF-AT-90; |
| Gene ID | 3609 |
| mRNA Refseq | NM_001137673 |
| Protein Refseq | NP_001131145 |
| MIM | 603182 |
| UniProt ID | Q12906 |
| ◆ Recombinant Proteins | ||
| ILF3-2710H | Recombinant Human ILF3 protein, His & T7-tagged | +Inquiry |
| ILF3-2767H | Recombinant Human ILF3 Protein (Tyr672-Tyr891), N-His tagged | +Inquiry |
| ILF3-5160H | Recombinant Human ILF3 Protein, GST-tagged | +Inquiry |
| ILF3-4524M | Recombinant Mouse ILF3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ILF3-1129HFL | Recombinant Full Length Human ILF3 Protein, C-Flag-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ILF3-5221HCL | Recombinant Human ILF3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ILF3 Products
Required fields are marked with *
My Review for All ILF3 Products
Required fields are marked with *
