Recombinant Full Length Human ILK Protein, GST-tagged
Cat.No. : | ILK-5795HF |
Product Overview : | Human ILK full-length ORF ( NP_001014794.1, 1 a.a. - 452 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 452 amino acids |
Description : | Transduction of extracellular matrix signals through integrins influences intracellular and extracellular functions, and appears to require interaction of integrin cytoplasmic domains with cellular proteins. Integrin-linked kinase (ILK), interacts with the cytoplasmic domain of beta-1 integrin. This gene encodes a serine/threonine protein kinase with 4 ankyrin-like repeats, which associates with the cytoplasmic domain of beta integrins and acts as a proximal receptor kinase regulating integrin-mediated signal transduction. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq |
Molecular Mass : | 77.8 kDa |
AA Sequence : | MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECPRLRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALDMARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEALQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPHVCKLMKICMNEDPAKRPKFDMIVPILEKMQDK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ILK integrin-linked kinase [ Homo sapiens ] |
Official Symbol | ILK |
Synonyms | ILK; integrin-linked kinase; integrin-linked protein kinase; ILK-1; p59ILK; integrin-linked kinase-2; 59 kDa serine/threonine-protein kinase; P59; ILK-2; DKFZp686F1765; |
Gene ID | 3611 |
mRNA Refseq | NM_001014794 |
Protein Refseq | NP_001014794 |
MIM | 602366 |
UniProt ID | Q13418 |
◆ Recombinant Proteins | ||
ILK-5158H | Recombinant Human ILK Protein, GST-tagged | +Inquiry |
ILK-3586H | Recombinant Human ILK protein, His-tagged | +Inquiry |
ILK-5768C | Recombinant Chicken ILK | +Inquiry |
ILK-1179H | Recombinant Human ILK Protein (1-228 aa), His-tagged | +Inquiry |
ILK-12H | Recombinant Human ILK, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ILK-5220HCL | Recombinant Human ILK 293 Cell Lysate | +Inquiry |
ILK-5219HCL | Recombinant Human ILK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ILK Products
Required fields are marked with *
My Review for All ILK Products
Required fields are marked with *
0
Inquiry Basket