Recombinant Full Length Human INIP Protein, GST-tagged

Cat.No. : INIP-3269HF
Product Overview : Human C9orf80 full-length ORF (NP_067041.1, 1 a.a. - 104 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 104 amino acids
Description : The protein encoded by this gene is a subunit of single-stranded DNA binding complexes that are important for maintaining genome stability. These complexes are involved in G2/M checkpoint control and homologous recombination repair. [provided by RefSeq, Jul 2016]
Molecular Mass : 37.8 kDa
AA Sequence : MAANSSGQGFQNKNRVAILAELDKEKRKLLMQNQSSTNHPGASIALSRPSLNKDFRDHAEQQHIAAQQKAALQHAHAHSSGYFITQDSAFGNLILPVLPRLDPE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name INIP INTS3 and NABP interacting protein [ Homo sapiens ]
Official Symbol INIP
Synonyms MISE; SOSSC; SSBIP1; C9orf80; HSPC043; hSSBIP1; RP11-276E15.2
Gene ID 58493
mRNA Refseq NM_021218
Protein Refseq NP_067041
MIM 613273
UniProt ID Q9NRY2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All INIP Products

Required fields are marked with *

My Review for All INIP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon