Recombinant Human INIP Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | INIP-1764H |
Product Overview : | C9orf80 MS Standard C13 and N15-labeled recombinant protein (NP_067041) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a subunit of single-stranded DNA binding complexes that are important for maintaining genome stability. These complexes are involved in G2/M checkpoint control and homologous recombination repair. |
Molecular Mass : | 11.4 kDa |
AA Sequence : | MAANSSGQGFQNKNRVAILAELDKEKRKLLMQNQSSTNHPGASIALSRPSLNKDFRDHAEQQHIAAQQKAALQHAHAHSSGYFITQDSAFGNLILPVLPRLDPETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | INIP INTS3 and NABP interacting protein [ Homo sapiens (human) ] |
Official Symbol | INIP |
Synonyms | MISE; SOSSC; SSBIP1; C9orf80; HSPC043; hSSBIP1; RP11-276E15.2 |
Gene ID | 58493 |
mRNA Refseq | NM_021218 |
Protein Refseq | NP_067041 |
MIM | 613273 |
UniProt ID | Q9NRY2 |
◆ Recombinant Proteins | ||
INIP-622C | Recombinant Cynomolgus INIP Protein, His-tagged | +Inquiry |
INIP-0214H | Recombinant Human INIP Protein, GST-Tagged | +Inquiry |
Inip-3540M | Recombinant Mouse Inip Protein, Myc/DDK-tagged | +Inquiry |
INIP-368C | Recombinant Cynomolgus Monkey INIP Protein, His (Fc)-Avi-tagged | +Inquiry |
INIP-1764H | Recombinant Human INIP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
INIP-7924HCL | Recombinant Human C9orf80 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All INIP Products
Required fields are marked with *
My Review for All INIP Products
Required fields are marked with *