Recombinant Full Length Human Intercellular Adhesion Molecule 1(Icam1) Protein, His-Tagged
Cat.No. : | RFL22358HF |
Product Overview : | Recombinant Full Length Human Intercellular adhesion molecule 1(ICAM1) Protein (P05362) (28-532aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (28-532) |
Form : | Lyophilized powder |
AA Sequence : | QTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYEIVIITVVAAAVIMGTAGLSTYLYNRQRKIKKYRLQQAQKGTPMKPNTQATPP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ICAM1 |
Synonyms | Antigen identified by monoclonal BB2; BB 2; BB2; CD 54; CD_antigen=CD54; CD54; Cell surface glycoprotein P3.58 ; Human rhinovirus receptor; ICAM 1; ICAM-1; ICAM1; ICAM1_HUMAN; intercellular adhesion molecule 1 (CD54); intercellular adhesion molecule 1 (CD |
UniProt ID | P05362 |
◆ Recombinant Proteins | ||
Icam1-1067R | Recombinant Rat Icam1 Protein, Fc-tagged | +Inquiry |
Icam1-1793R | Recombinant Rat Intercellular Adhesion Molecule 1 | +Inquiry |
ICAM1-278H | Recombinant Human Intercellular Adhesion Molecule-1, His-tagged | +Inquiry |
ICAM1-23M | Recombinant Mouse Icam1 Protein, His-tagged | +Inquiry |
RFL22358HF | Recombinant Full Length Human Intercellular Adhesion Molecule 1(Icam1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ICAM1-2655HCL | Recombinant Human ICAM1 cell lysate | +Inquiry |
ICAM1-2487MCL | Recombinant Mouse ICAM1 cell lysate | +Inquiry |
ICAM1-1970RCL | Recombinant Rat ICAM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ICAM1 Products
Required fields are marked with *
My Review for All ICAM1 Products
Required fields are marked with *
0
Inquiry Basket