Recombinant Full Length Human Intercellular Adhesion Molecule 1(Icam1) Protein, His-Tagged

Species :	Human
Source :	E.coli
Tag :	His
Protein Length :	Full Length of Mature Protein (28-532)
Form :	Lyophilized powder
AA Sequence :	QTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYEIVIITVVAAAVIMGTAGLSTYLYNRQRKIKKYRLQQAQKGTPMKPNTQATPP
Purity :	Greater than 90% as determined by SDS-PAGE.
Applications :	SDS-PAGE
Notes :	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Storage :	Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Storage Buffer :	Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution :	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Name	ICAM1
Synonyms	Antigen identified by monoclonal BB2; BB 2; BB2; CD 54; CD_antigen=CD54; CD54; Cell surface glycoprotein P3.58 ; Human rhinovirus receptor; ICAM 1; ICAM-1; ICAM1; ICAM1_HUMAN; intercellular adhesion molecule 1 (CD54); intercellular adhesion molecule 1 (CD
UniProt ID	P05362

Required fields are marked with *

Required fields are marked with *

Overall Rating *

Cat NO.

Review

Your Name

Phone Number

E-mail Address

Cat.No. :	RFL22358HF
Product Overview :	Recombinant Full Length Human Intercellular adhesion molecule 1(ICAM1) Protein (P05362) (28-532aa), fused to N-terminal His tag, was expressed in E. coli.