Recombinant Full Length Human Interferon Alpha-Inducible Protein 27-Like Protein 1(Ifi27L1) Protein, His-Tagged
Cat.No. : | RFL3208HF |
Product Overview : | Recombinant Full Length Human Interferon alpha-inducible protein 27-like protein 1(IFI27L1) Protein (Q96BM0) (1-104aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-104) |
Form : | Lyophilized powder |
AA Sequence : | MGKESGWDSGRAAVAAVVGGVVAVGTVLVALSAMGFTSVGIAASSIAAKMMSTAAIANGG GVAAGSLVAILQSVGAAGLSVTSKVIGGFAGTALGAWLGSPPSS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | IFI27L1 |
Synonyms | IFI27L1; FAM14B; Interferon alpha-inducible protein 27-like protein 1; Interferon-stimulated gene 12c protein; ISG12(c; ISG12C |
UniProt ID | Q96BM0 |
◆ Recombinant Proteins | ||
IFI27L1-3135H | Recombinant Human IFI27L1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL3208HF | Recombinant Full Length Human Interferon Alpha-Inducible Protein 27-Like Protein 1(Ifi27L1) Protein, His-Tagged | +Inquiry |
IFI27L1-1052H | Recombinant Human IFI27L1 | +Inquiry |
IFI27L1-1151H | Recombinant Human IFI27L1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFI27L1-5295HCL | Recombinant Human IFI27L1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFI27L1 Products
Required fields are marked with *
My Review for All IFI27L1 Products
Required fields are marked with *