Recombinant Full Length Human IRAK3 Protein, C-Flag-tagged
Cat.No. : | IRAK3-1792HFL |
Product Overview : | Recombinant Full Length Human IRAK3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the interleukin-1 receptor-associated kinase protein family. Members of this family are essential components of the Toll/IL-R immune signal transduction pathways. This protein is primarily expressed in monocytes and macrophages and functions as a negative regulator of Toll-like receptor signaling. Mutations in this gene are associated with a susceptibility to asthma. Alternate splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 67.6 kDa |
AA Sequence : | MAGNCGARGALSAHTLLFDLPPALLGELCAVLDSCDGALGWRGLAERLSSSWLDVRHIEKYVDQGKSGTR ELLWSWAQKNKTIGDLLQVLQEMGHRRAIHLITNYGAVLSPSEKSYQEGGFPNILFKETANVTVDNVLIP EHNEKGVLLKSSISFQNIIEGTRNFHKDFLIGEGEIFEVYRVEIQNLTYAVKLFKQEKKMQCKKHWKRFL SELEVLLLFHHPNILELAAYFTETEKFCLIYPYMRNGTLFDRLQCVGDTAPLPWHIRIGILIGISKAIHY LHNVQPCSVICGSISSANILLDDQFQPKLTDFAMAHFRSHLEHQSCTINMTSSSSKHLWYMPEEYIRQGK LSIKTDVYSFGIVIMEVLTGCRVVLDDPKHIQLRDLLRELMEKRGLDSCLSFLDKKVPPCPRNFSAKLFC LAGRCAATRAKLRPSMDEVLNTLESTQASLYFAEDPPTSLKSFRCPSPLFLENVPSIPVEDDESQNNNLL PSDEGLRIDRMTQKTPFECSQSEVMFLSLDKKPESKRNEEACNMPSSSCEESWFPKYIVPSQDLRPYKVN IDPSSEAPGHSCRSRPVESSCSSKFSWDEYEQYKKE myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protein Kinase |
Protein Pathways : | Apoptosis, Neurotrophin signaling pathway |
Full Length : | Full L. |
Gene Name | IRAK3 interleukin 1 receptor associated kinase 3 [ Homo sapiens (human) ] |
Official Symbol | IRAK3 |
Synonyms | ASRT5; IRAKM |
Gene ID | 11213 |
mRNA Refseq | NM_007199.3 |
Protein Refseq | NP_009130.2 |
MIM | 604459 |
UniProt ID | Q9Y616 |
◆ Recombinant Proteins | ||
IRAK3-1192H | Recombinant Human IRAK3 Protein, His (Fc)-Avi-tagged | +Inquiry |
IRAK3-5051H | Recombinant Human IRAK3 Protein, GST-tagged | +Inquiry |
IRAK3-1792HFL | Recombinant Full Length Human IRAK3 Protein, C-Flag-tagged | +Inquiry |
IRAK3-5731HF | Recombinant Full Length Human IRAK3 Protein, GST-tagged | +Inquiry |
Irak3-2234M | Recombinant Mouse Irak3 protein, His&Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IRAK3-5170HCL | Recombinant Human IRAK3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IRAK3 Products
Required fields are marked with *
My Review for All IRAK3 Products
Required fields are marked with *
0
Inquiry Basket