Recombinant Full Length Human IRF8 Protein, GST-tagged
Cat.No. : | IRF8-5742HF |
Product Overview : | Human IRF8 full-length ORF ( NP_002154.1, 1 a.a. - 426 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 426 amino acids |
Description : | Interferon consensus sequence-binding protein (ICSBP) is a transcription factor of the interferon (IFN) regulatory factor (IRF) family. Proteins of this family are composed of a conserved DNA-binding domain in the N-terminal region and a divergent C-terminal region that serves as the regulatory domain. The IRF family proteins bind to the IFN-stimulated response element (ISRE) and regulate expression of genes stimulated by type I IFNs, namely IFN-alpha and IFN-beta. IRF family proteins also control expression of IFN-alpha and IFN-beta-regulated genes that are induced by viral infection. [provided by RefSeq |
Molecular Mass : | 74.8 kDa |
AA Sequence : | MCDRNGGRRLRQWLIEQIDSSMYPGLIWENEEKSMFRIPWKHAGKQDYNQEVDASIFKAWAVFKGKFKEGDKAEPATWKTRLRCALNKSPDFEEVTDRSQLDISEPYKVYRIVPEEEQKCKLGVATAGCVNEVTEMECGRSEIDELIKEPSVDDYMGMIKRSPSPPEACRSQLLPDWWAQQPSTGVPLVTGYTTYDAHHSAFSQMVISFYYGGKLVGQATTTCPEGCRLSLSQPGLPGTKLYGPEGLELVRFPPADAIPSERQRQVTRKLFGHLERGVLLHSSRQGVFVKRLCQGRVFCSGNAVVCKGRPNKLERDEVVQVFDTSQFFRELQQFYNSQGRLPDGRVVLCFGEEFPDMAPLRSKLILVQIEQLYVRQLAEEAGKSCGAGSVMQAPEEPPPDQVFRMFPDICASHQRSFFRENQQITV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | IRF8 interferon regulatory factor 8 [ Homo sapiens ] |
Official Symbol | IRF8 |
Synonyms | IRF8; interferon regulatory factor 8; ICSBP1, interferon consensus sequence binding protein 1; ICSBP; IRF 8; interferon consensus sequence binding protein 1; IRF-8; ICSBP1; H-ICSBP; |
Gene ID | 3394 |
mRNA Refseq | NM_002163 |
Protein Refseq | NP_002154 |
MIM | 601565 |
UniProt ID | Q02556 |
◆ Recombinant Proteins | ||
IRF8-2301R | Recombinant Rhesus monkey IRF8 Protein, His-tagged | +Inquiry |
IRF8-4899H | Recombinant Human IRF8 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
IRF8-735Z | Recombinant Zebrafish IRF8 | +Inquiry |
Irf8-1206M | Recombinant Mouse Irf8 Protein, MYC/DDK-tagged | +Inquiry |
IRF8-2122R | Recombinant Rhesus Macaque IRF8 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IRF8-5159HCL | Recombinant Human IRF8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IRF8 Products
Required fields are marked with *
My Review for All IRF8 Products
Required fields are marked with *
0
Inquiry Basket