Recombinant Mouse IRF8 Protein (1-424 aa), His-SUMO-tagged
Cat.No. : | IRF8-586M |
Product Overview : | Recombinant Mouse IRF8 Protein (1-424 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-424 aa |
Description : | Specifically binds to the upstream regulatory region of type I IFN and IFN-inducible MHC class I genes (the interferon consensus sequence (ICS)). Plays a regulatory role in cells of the immune syst. Involved in CD8+ dendritic cell differentiation by forming a complex with the BATF-JUNB heterodimer in immune cells, leading to recognition of AICE sequence (5'-TGAnTCA/GAAA-3'), an immune-specific regulatory elent, followed by cooperative binding of BATF and IRF8 and activation of genes. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 64.2 kDa |
AA Sequence : | MCDRNGGRRLRQWLIEQIDSSMYPGLIWENDEKTMFRIPWKHAGKQDYNQEVDASIFKAWAVFKGKFKEGDKAEPATWKTRLRCALNKSPDFEEVTDRSQLDISEPYKVYRIVPEEEQKCKLGVAPAGCMSEVPEMECGRSEIEELIKEPSVDEYMGMTKRSPSPPEACRSQILPDWWVQQPSAGLPLVTGYAAYDTHHSAFSQMVISFYYGGKLVGQATTTCLEGCRLSLSQPGLPKLYGPDGLEPVCFPTADTIPSERQRQVTRKLFGHLERGVLLHSNRKGVFVKRLCQGRVFCSGNAVVCKGRPNKLERDEVVQVFDTNQFIRELQQFYATQSRLPDSRVVLCFGEEFPDTVPLRSKLILVQVEQLYARQLVEEAGKSCGAGSLMPALEEPQPDQAFRMFPDICTSHQRPFFRENQQITV |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | Irf8 interferon regulatory factor 8 [ Mus musculus ] |
Official Symbol | IRF8 |
Synonyms | IRF8; Myls; ICSBP; IRF-8; Icsbp1; AI893568; |
Gene ID | 15900 |
mRNA Refseq | NM_008320 |
Protein Refseq | NP_032346 |
UniProt ID | P23611 |
◆ Recombinant Proteins | ||
IRF8-2122R | Recombinant Rhesus Macaque IRF8 Protein, His (Fc)-Avi-tagged | +Inquiry |
IRF8-5742HF | Recombinant Full Length Human IRF8 Protein, GST-tagged | +Inquiry |
Irf8-1206M | Recombinant Mouse Irf8 Protein, MYC/DDK-tagged | +Inquiry |
IRF8-156H | Recombinant Human IRF8, His-tagged | +Inquiry |
Irf8-1785M | Recombinant Mouse Irf8 protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IRF8-5159HCL | Recombinant Human IRF8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IRF8 Products
Required fields are marked with *
My Review for All IRF8 Products
Required fields are marked with *
0
Inquiry Basket