Recombinant Full Length Human IRF9 Protein, GST-tagged
Cat.No. : | IRF9-5763HF |
Product Overview : | Human ISGF3G full-length ORF ( AAH35716, 1 a.a. - 393 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 393 amino acids |
Description : | IRF9 (Interferon Regulatory Factor 9) is a Protein Coding gene. Diseases associated with IRF9 include Skin Papilloma and Hepatitis C. Among its related pathways are Type I Interferon Signaling Pathways and Immune response IFN alpha/beta signaling pathway. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and regulatory region DNA binding. An important paralog of this gene is IRF4. |
Molecular Mass : | 68.97 kDa |
AA Sequence : | MASGRARCTRKLRNWVVEQVESGQFPGVCWDDTAKTMFRIPWKHAGKQDFREDQDAAFFKAWAIFKGKYKEGDTGGPAVWKTRLRCALNKSSEFKEVPERGRMDVAEPYKVYQLLPPGIVSGQPGTQKVPSKRQHSSVSSERKEEEDAMQNCTLSPSVLQDSLNNEEEGASGGAVHSDIGSSSSSSSPEPQEVTDTTEAPFQGDQRSLEFLLPPEPDYSLLLTFIYNGRVVGEAQVQSLDCRLVAEPSGSESSMEQVLFPKPGPLEPTQRLLSQLERGILVASNPRGLFVQRLCPIPISWNAPQAPPGPGPHLLPSNECVELFRTAYFCRDLVRYFQGLGPPPKFQVTLNFWEESHGSSHTPQNLITVKMEQAFARYLLEQTPEQQAAILSLV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | IRF9 interferon regulatory factor 9 [ Homo sapiens ] |
Official Symbol | IRF9 |
Synonyms | IRF9; interferon regulatory factor 9; interferon stimulated transcription factor 3, gamma (48kD) , interferon stimulated transcription factor 3, gamma 48kDa , ISGF3G; ISGF-3 gamma; ISGF3 p48 subunit; interferon-stimulated gene factor 3 gamma; transcriptional regulator ISGF3 subunit gamma; IFN-alpha-responsive transcription factor subunit; interferon-stimulated transcription factor 3, gamma 48kDa; interferon-stimulated transcription factor 3, gamma (48kD); p48; IRF-9; ISGF3; ISGF3G; |
Gene ID | 10379 |
mRNA Refseq | NM_006084 |
Protein Refseq | NP_006075 |
MIM | 147574 |
UniProt ID | Q00978 |
◆ Recombinant Proteins | ||
IRF9-376C | Recombinant Cynomolgus Monkey IRF9 Protein, His (Fc)-Avi-tagged | +Inquiry |
IRF9-630C | Recombinant Cynomolgus IRF9 Protein, His-tagged | +Inquiry |
IRF9-11731Z | Recombinant Zebrafish IRF9 | +Inquiry |
IRF9-1758HFL | Recombinant Full Length Human IRF9 Protein, C-Flag-tagged | +Inquiry |
Irf9-3586M | Recombinant Mouse Irf9 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IRF9-5158HCL | Recombinant Human IRF9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IRF9 Products
Required fields are marked with *
My Review for All IRF9 Products
Required fields are marked with *
0
Inquiry Basket