Recombinant Full Length Human ISCA1 Protein, GST-tagged
Cat.No. : | ISCA1-3497HF |
Product Overview : | Human HBLD2 full-length ORF ( AAH02675, 1 a.a. - 129 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 129 amino acids |
Description : | ISCA1 is a mitochondrial protein involved in the biogenesis and assembly of iron-sulfur clusters, which play a role in electron-transfer reactions (Cozar-Castellano et al., 2004 [PubMed 15262227]).[supplied by OMIM |
Molecular Mass : | 39.93 kDa |
AA Sequence : | MSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGVKVGVRTRGCNGLSYTLEYTKTKGDSDEEVIQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ISCA1 iron-sulfur cluster assembly 1 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | ISCA1 |
Synonyms | ISCA1; iron-sulfur cluster assembly 1 homolog (S. cerevisiae); HBLD2, HESB like domain containing 2; iron-sulfur cluster assembly 1 homolog, mitochondrial; hIscA; ISA1; MGC4276; HESB like domain containing 2; iron sulfur assembly protein IscA; iron-sulfur assembly protein IscA; HESB-like domain-containing protein 2; HBLD2; RP11-507D14.2; |
Gene ID | 81689 |
mRNA Refseq | NM_030940 |
Protein Refseq | NP_112202 |
MIM | 611006 |
UniProt ID | Q9BUE6 |
◆ Recombinant Proteins | ||
ISCA1-2756R | Recombinant Rat ISCA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ISCA1-3241H | Recombinant Human ISCA1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ISCA1-4605H | Recombinant Human ISCA1 Protein, GST-tagged | +Inquiry |
ISCA1-8323M | Recombinant Mouse ISCA1 Protein | +Inquiry |
ISCA1-3100R | Recombinant Rat ISCA1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ISCA1-5155HCL | Recombinant Human ISCA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ISCA1 Products
Required fields are marked with *
My Review for All ISCA1 Products
Required fields are marked with *